SecReT6
Protein ID: 15799903
SecReT6 ID6
T6SS typei1
Gene symbol-
Locus tagZ0254
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]251126..253897 [-]
Productprotease
NoteTssH
UniProt IDQ8X7V7
KEGG IDece:Z0254, ecs:ECs0223
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.70E-39, Aligned region: 224..242
AAA_2 [PF07724], Evalue: 9.70E-39, Aligned region: 646..807
AAA [PF00004], Evalue: 5.70E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 5.70E-17, Aligned region: 652..769
AAA [PF00004], Evalue: 5.70E-17, Aligned region: 780..843
AAA_5 [PF07728], Evalue: 7.00E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 7.00E-14, Aligned region: 651..771
ClpB_D2-small [PF10431], Evalue: 1.20E-12, Aligned region: 813..889
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 19..46
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 622..692
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 717..745
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 447..482
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 650..685
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 646..680
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 778..843
AAA_29 [PF13555], Evalue: 6.50E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 6.50E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 6.50E-05, Aligned region: 649..676
AAA_14 [PF13173], Evalue: 9.10E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 9.10E-05, Aligned region: 651..741
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 283..345
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 652..680
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 645..673
DUF258 [PF03193], Evalue: 0.0003, Aligned region: 197..239
DUF258 [PF03193], Evalue: 0.0003, Aligned region: 652..670
AAA_18 [PF13238], Evalue: 0.0053, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0053, Aligned region: 652..686
IstB_IS21 [PF01695], Evalue: 0.0091, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0091, Aligned region: 651..662
AAA_17 [PF13207], Evalue: 0.0094, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0094, Aligned region: 652..686
Protein Sequence: 923 a.a.     [Download]
>gi|15799903|ref|NP_285915.1| unnamed protein product [Escherichia coli O157:H7 str. EDL933]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDASDTLLARYAKNMTEDARNGRLAPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESEQDNTGAVPADETDREQPEETAETVSPVQRL
AQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASL
HKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSP
PGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNL
GYQVIVEHADDPETMQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAE
VVIEPEVTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAVDGAFTADVEDA
QNDESVTKDETVL
 
Nucleotide Sequence: 2772 bp     [Download]
>gi|16445223|ref|NC_002655.2|:c253897-251126 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCAGAATGTATGAGCCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTTATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
TTGACGGTAGAGAACTACACAACCGCCCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTG
AGTGGCTTAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTT
GCTGCTGGCCTTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACACTGACGGACGCCTCTGACACCCTGCTTGCCCGCTACGCCAAAAACAT
GACAGAAGACGCCCGTAACGGCAGGCTAGCCCCAGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGAAGCAGGCGTGGGTAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAACTGAAAAACACCGATATCAT
GACCCTTGACCTGGGCGCATTGCAGGCCGGGGCATCGGTGAAGGGTGAGTTTGAAAAACGCTTCAAGGGG
CTGATGGCGGAGGTCATTTCCTCTCCGGTGCCGGTCATTCTGTTTATCGACGAAGCGCATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTGAAACCGGCGCTGGCGCGTGGCGAACT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAGAAAGACGCCGCCCTGTCGCGC
CGCTTCCAGTTAGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGTGGTCTGTCGG
CGGTCTATGAACGGTCTCACGGCGTGCTGATTGACGATGATGCCTTGCAGGCCGCAGCAACGCTGAGCGA
ACGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCTTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACTGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAGTCAGAACAGGATAATACCGGTGCCGT
ACCGGCTGATGAGACCGACAGAGAACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCGGTACAGCGGCTG
GCCCAGCTCACTGCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTCTCCCCGCACGTCGATAAAA
AACAGATTGCGGCGGTGATTGCCGAATGGACCGGCGTGCCGCTCAACCGCCTGTCGCAGAATGAAATGTC
GGTCATCACCGACCTGCCGAAATGGCTGGGCGACACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTG
CATAAGCATCTACTGACCGCACGCGCCGACCTGCGTCGTCCGGGACGCCCGCTCGGTGCGTTCCTGCTCG
CTGGCCCCAGCGGCGTGGGTAAAACCGAAACCGTCCTGCAACTGGCAGAGCTGCTCTACGGCGGTCGCCA
GTACCTGACCACCATCAATATGTCCGAGTTCCAGGAGAAACACACCGTTTCGCGGCTGATTGGCTCCCCT
CCGGGCTATGTCGGCTATGGCGAAGGCGGCGTGCTGACTGAAGCCATCCGCCAGAAACCCTACTCGGTGG
TGCTGCTCGATGAAGTGGAAAAAGCGCACCCGGATGTCCTCAACCTGTTCTACCAGGCGTTTGACAAGGG
CGAGATGGCCGACGGCGAAGGCCGCCTGATTGACTGTAAAAACATCGTCTTCTTCCTCACCTCCAACCTC
GGTTACCAGGTGATTGTCGAACACGCGGATGACCCGGAAACCATGCAGGAAGCCCTCTATCCGGTGCTGG
CGGACTTCTTTAAACCTGCCCTGCTGGCGCGAATGGAGGTGGTGCCGTACCTGCCGCTGTCGAAAGAGAC
GCTCGCCACCATTATCGCCGGGAAACTGGCCCGTCTGGATAACGTGCTGCGCAGTCGCTTTGGTGCAGAA
GTGGTCATTGAACCGGAAGTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGA
TGCTGGAATCTGTCATCGATGGCGACATGCTACCGCCGCTCTCGCTGCTGCTGTTGCAGAAAATGGCGGC
TAACACGGCGATTGCCCGGATTCGGTTGTCGGCAGTGGACGGCGCATTTACGGCAGACGTGGAAGATGCT
CAGAACGACGAGTCCGTCACAAAGGATGAAACGGTTTTATGA