SecReT6
Protein ID: 15799904
SecReT6 ID6
T6SS typei1
Gene symbol-
Locus tagZ0255
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]253906..254667 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ8X7V4
KEGG IDecs:ECs0224, ece:Z0255
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.20E-62, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|15799904|ref|NP_285916.1| unnamed protein product [Escherichia coli O157:H7 str. EDL933]
MDEGSLSLPPFTGYDEKSLRDYHLALHGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWLCFSLGFRGRYKVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTVKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|16445223|ref|NC_002655.2|:c254667-253906 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGATACGACGAAAAAAGCCTGCGCGACTACCATC
TCGCGCTTCATGGCAACAGCCTGAATCCGATGATCGACGCGGCGACGCCGCTACTCGGTATGGTAATGCG
CCTTTCCACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACAGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAACAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCGAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGCGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGCTCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGTACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGTCTGTACCACGTTCTGCATAAACT
GCGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAAGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACTGTTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA