SecReT6
Protein ID: 15799907
SecReT6 ID6
T6SS typei1
Gene symbol-
Locus tagZ0258
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]256527..257828 [-]
Producthypothetical protein
NoteFha
UniProt IDQ8X7U8
KEGG IDece:Z0258
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 433 a.a.     [Download]
>gi|15799907|ref|NP_285919.1| unnamed protein product [Escherichia coli O157:H7 str. EDL933]
MIITEQNMPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSVQDRQQSIPAQAFTVILHD
GTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDML
TDTLLSTEGAPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGG
INTPFMDLPPIYASPGDHNDDISAAEMAQRHLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKG
LLDLQQQRNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAA
IVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVY
DRVLREKQREPEA
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|16445223|ref|NC_002655.2|:c257828-256527 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
ATGATAATCACGGAGCAGAATATGCCGGAAGAGAAACTACAGACGCTTTCATTGCAGGTCATTAACGGCA
GTGAGCTGGAAAGCGGGCGGGCGGCGCGCTGTCTGTTCACACAGCAGGGAAATGTCGGCCATGCCCCCGA
ATGCCACTGGTCGGTACAGGATCGTCAGCAGAGCATTCCGGCCCAGGCTTTTACCGTTATCCTGCACGAT
GGCACATTTTGTCTACGCCCGCAGACGGCACAACTGTGGCTGAATCAGGCAAAAGTCACAGCAACATCAG
ACCTGATACAGTTGCGCCAGGGCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCG
GGGAGATATTCCCCATTACGATGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTC
ACGGATACCCTGCTATCAACGGAGGGTGCGCCACACTATCCGGGAATGACTCACCGGCACCAGCTTGCAG
ACACCGTGGTAAATGGTTTTTCTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGG
CGATCCGCTTTCAGGCATTGCGGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGG
ATCAATACTCCGTTTATGGATCTGCCGCCCATTTATGCCAGCCCTGGCGATCATAATGATGACATCTCTG
CGGCAGAAATGGCGCAACGCCACCTTGCGGTCACCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCGT
GAGCAATTCCGACGATGCGGATGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGT
CTGCTCGATTTGCAGCAGCAGCGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGC
TGCGCCTGAACATGGATTACGCCACCGCGCTCGACGTGATGTTTGCCGAAGGTAAAAGCCCGGTACATCT
GGCGGCTCCCGCCGCCGTCAGTGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCGGCG
ATTGTGGAGTCGCTTCGTGTCCTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGT
ACCGCCGCAGCCATGAACTGCGCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTA
CGAAGAACTGGCCTCCGATCGCCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAGGTCTAT
GACCGGGTGCTTCGTGAAAAACAGCGGGAGCCGGAAGCATGA