SecReT6
Protein ID: 15799910
SecReT6 ID6
T6SS typei1
Gene symbol-
Locus tagZ0261
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]260732..261145 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ8X7U0
KEGG IDece:Z0261, ecs:ECs0230
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-18, Aligned region: 29..118
Protein Sequence: 137 a.a.     [Download]
>gi|15799910|ref|NP_285922.1| unnamed protein product [Escherichia coli O157:H7 str. EDL933]
MILDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILNTRSGSCRGAPELGIDEPEGAENFRE
SMSRAIEQCIERYEPRISHAEVQAVVSSASSPLDMTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD
 
Nucleotide Sequence: 414 bp     [Download]
>gi|16445223|ref|NC_002655.2|:c261145-260732 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
ATGATACTGGATCGGGAAAGAACCACAGGTTCTCTTTTTGAGCGTATGGAAGCCTCTTCGGCCAGAAACC
GGCAGGGAGGCAGTATTCATTCGCTCAGGCAATCCATTCGCCAGAACCTAAGAAACATTCTTAATACCCG
GTCCGGTAGTTGCCGGGGTGCGCCTGAGCTGGGCATTGATGAACCGGAAGGGGCTGAAAACTTCCGCGAA
TCCATGAGTCGGGCCATCGAGCAATGTATAGAACGCTATGAACCCCGGATCTCACACGCTGAAGTGCAGG
CAGTGGTTTCATCCGCCTCCAGCCCGCTGGATATGACGTTTCATATTACAGCCTGGGTGACATTTAACGA
AACGCATGAGGTGCTTGAATTTGATATGGCACCGAATGGCAGCCAGCATTACCGGGTGGACTGA