SecReT6
Protein ID: 15829470
SecReT6 ID8
T6SS typei1
Gene symbol-
Locus tagECs0216
StrainEscherichia coli O157:H7 str. Sakai
Repliconchromosome [GenBank: NC_002695] [Browse all T6SS(s) in this replicon]
Location [Strand]243533..244012 [-]
ProductHcp-like protein
NoteTssD
UniProt IDQ8X7X3
KEGG IDece:Z0248, ecs:ECs0216
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.70E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|15829470|ref|NP_308243.1| Hcp-like protein [Escherichia coli O157:H7 str. Sakai]
MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFMHGLNRDQNVNHHHLTIKKPIDKASP
LLGKAICDNELLTCDFSFYRTNKFGINELFYKIKLTGAKISDIHVSISHIVVDNSVQPEESVSFSYESII
WEHCSAGTSAYSLWEDRLF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|15829254|ref|NC_002695.1|:c244012-243533 Escherichia coli O157:H7 str. Sakai chromosome, complete genome
ATGGCGAATTTAATTTATTTAACACTAAATGGTGATAATCAAGGGCTCATTTCAAGTGGTTGTTCATCAC
AACCATCCATTGGAAATAAAGCTCAAACAGCACACATTGATCAAATTATGATTTATGAATTCATGCATGG
ATTAAATCGAGATCAAAACGTCAACCATCATCATTTGACAATAAAAAAACCTATAGATAAAGCATCACCC
TTATTAGGCAAAGCAATTTGCGACAATGAATTATTGACATGTGATTTTTCCTTTTATCGTACAAATAAAT
TTGGAATTAATGAACTGTTCTATAAAATCAAATTAACTGGAGCAAAGATAAGCGACATTCATGTCTCTAT
ATCACATATTGTTGTTGATAACAGCGTTCAACCCGAAGAGTCAGTTTCTTTCAGTTATGAGTCAATTATA
TGGGAGCATTGTTCCGCTGGCACTAGTGCATACAGTTTATGGGAAGATCGTCTTTTTTAA