SecReT6
Protein ID: 15829471
SecReT6 ID8
T6SS typei1
Gene symbol-
Locus tagECs0217
StrainEscherichia coli O157:H7 str. Sakai
Repliconchromosome [GenBank: NC_002695] [Browse all T6SS(s) in this replicon]
Location [Strand]243978..245387 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ7AHJ8
KEGG IDecs:ECs0217
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 6.00E-44, Aligned region: 139..154
DUF3702 [PF12486], Evalue: 6.00E-44, Aligned region: 292..436
ImpA-rel_N [PF06812], Evalue: 6.20E-21, Aligned region: 41..100
Protein Sequence: 469 a.a.     [Download]
>gi|15829471|ref|NP_308244.1| hypothetical protein ECs0217 [Escherichia coli O157:H7 str. Sakai]
MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLAR
TRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERA
LQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPP
LPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAA
TVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLR
GWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNTIPTIKKALNFNNIHEYKGVLNGEFNLFNTKW
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|15829254|ref|NC_002695.1|:c245387-243978 Escherichia coli O157:H7 str. Sakai chromosome, complete genome
ATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCGCGGGCTGCCGGAATTCAGCG
CCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTGAACTGGAAACTGGTGGAGTC
GCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCACCTACTATACGCTTGCCCGG
ACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGCGGCAATGGTAAGCCACGACT
GGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGACTGGTTTAACTCCCGAACCGG
CAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGATCTACCGCACAGAGCGGGCA
TTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCCGCGCGTGGAGAATCTGCTCT
ATTTTATGCAGAACACGCGTAAACGGCTTGAACCCCAGCTGAAGAGTAACACTGAGAACGCCGCACAGAC
CACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACACCAGAAGCGGTAGTGCCTCCC
CTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTGCGCAGTCTGACAGAGAATCCCCCACAGGCCAGTGTGA
TAAAGCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCAGTGGCTGTCGCCTCAGCATT
GTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACGACACCGCTCAGGGCGCAGCA
ACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCAACAACTTCTTGATACCTCCC
CGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGTCGCTGGCCGGAAAGCCTGCA
ACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCACAGAGTAGCCCGCAGTTGCGT
GGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGATGCAGCGCGAGAAAGAGGGAC
TAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTGGGGCAGGAAACACCCGTTGA
GTCTCTGTTGACGCAGTACCAGGATGCCCGTGCGCAGAAGCAGAATACAGATGCGCTGGAAAAACAAATT
AATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAATACGATACCGACGATAAAAA
AAGCATTGAATTTCAATAACATTCATGAATACAAAGGAGTTTTAAATGGCGAATTTAATTTATTTAACAC
TAAATGGTGA