SecReT6
Protein ID: 15829474
SecReT6 ID8
T6SS typei1
Gene symbol-
Locus tagECs0220
StrainEscherichia coli O157:H7 str. Sakai
Repliconchromosome [GenBank: NC_002695] [Browse all T6SS(s) in this replicon]
Location [Strand]248969..249763 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ8X7W2
KEGG IDece:Z0251, ecs:ECs0220
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 264 a.a.     [Download]
>gi|15829474|ref|NP_308247.1| hypothetical protein ECs0220 [Escherichia coli O157:H7 str. Sakai]
MTQPSAPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAA
VSADMVADYQSRLASADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRFLERLPQ
LTGLLFNDRTPFLSEQTKQWLAASPDGKVAPVAQIGEESQAARACFAGQGLEAALRYLDMLPEGDPRDQF
HRQYLAAQLTEEAGLIQLAQQQYRMLLMIGSQMMVSDWEPSLLTQLEQKFTAEQ
 
Nucleotide Sequence: 795 bp     [Download]
>gi|15829254|ref|NC_002695.1|:c249763-248969 Escherichia coli O157:H7 str. Sakai chromosome, complete genome
GTGACGCAACCCAGTGCTCCGGCTCCCCAAATCGCCATCGACAGTCACGACGACAAAGCCTGGCGCGACA
CGCTGTTAAAAGTGGCGGCTATTTTATGTGAACGCCAGCCGGACTCGCCGCAGGGCTATCGCCTGCGCCG
CCATGCCCTGTGGCAATCCATCACCAGTACACCCCAGGCGGAAAGCGATGGACGTACCCCACTGGCTGCG
GTCTCTGCCGATATGGTGGCGGATTACCAGTCCCGGCTTGCCAGCGCGGATATGGCGCTGTGGCAACAGG
TTGAGAAAAGCGTATTGCTGGCTCCTTACTGGCTGGACGGTCACTGTCTTTCTGCACAGACGGCACTGCG
TCTGGGTTACAAACAGGTGGCAGACACCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAG
CTTACCGGGCTGCTGTTTAATGACCGCACACCGTTTCTCAGTGAGCAGACGAAACAATGGCTGGCTGCTT
CGCCCGACGGCAAAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGCAGGCAGCCAGAGCCTGTTTTGC
TGGGCAGGGTCTGGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTT
CACCGCCAGTACCTTGCCGCACAGTTGACGGAGGAGGCGGGGCTGATACAGCTTGCGCAGCAACAGTACC
GGATGTTGTTGATGATAGGGAGTCAGATGATGGTGTCTGACTGGGAGCCATCATTACTTACGCAGCTTGA
ACAAAAATTCACGGCAGAACAATAA