SecReT6
Protein ID: 15829478
SecReT6 ID8
T6SS typei1
Gene symbol-
Locus tagECs0224
StrainEscherichia coli O157:H7 str. Sakai
Repliconchromosome [GenBank: NC_002695] [Browse all T6SS(s) in this replicon]
Location [Strand]253905..254666 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ8X7V4
KEGG IDecs:ECs0224, ece:Z0255
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.20E-62, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|15829478|ref|NP_308251.1| hypothetical protein ECs0224 [Escherichia coli O157:H7 str. Sakai]
MDEGSLSLPPFTGYDEKSLRDYHLALHGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWLCFSLGFRGRYKVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTVKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|15829254|ref|NC_002695.1|:c254666-253905 Escherichia coli O157:H7 str. Sakai chromosome, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGATACGACGAAAAAAGCCTGCGCGACTACCATC
TCGCGCTTCATGGCAACAGCCTGAATCCGATGATCGACGCGGCGACGCCGCTACTCGGTATGGTAATGCG
CCTTTCCACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACAGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAACAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCGAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGCGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGCTCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGTACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGTCTGTACCACGTTCTGCATAAACT
GCGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAAGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACTGTTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA