SecReT6
Protein ID: 15829479
SecReT6 ID8
T6SS typei1
Gene symbol-
Locus tagECs0225
StrainEscherichia coli O157:H7 str. Sakai
Repliconchromosome [GenBank: NC_002695] [Browse all T6SS(s) in this replicon]
Location [Strand]254671..256002 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ8X7V2
KEGG IDece:Z0256, ecs:ECs0225
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.80E-148, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|15829479|ref|NP_308252.1| hypothetical protein ECs0225 [Escherichia coli O157:H7 str. Sakai]
MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWGFTELTLNNELLAQGKIMIDSASGTL
PDGTVFSIPDQDALPDPLHPQNFPDERSRNIYLALPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGD
ARTLTLGQLTPRIMSGAEDMSAYITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAI
GGRASDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAELLGELMTFTEPS
RLPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSELLQSATFVLAVAA
NMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFSYFELDKSGQAWTEMAAA
GAVALHVSGSFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|15829254|ref|NC_002695.1|:c256002-254671 Escherichia coli O157:H7 str. Sakai chromosome, complete genome
ATGGCAACCACCCGCAACAAGGTGATGTGGCAGGAAGGGATGCTGATGCGCCCACACCATTTCCAGCAAC
AGCAGCGTTACAACGACTACCTGGATAACCAGCGTTTCCGGGCCATGAATGATTTATCCTGGGGATTTAC
CGAACTCACCCTCAACAATGAACTGCTGGCGCAGGGTAAGATCATGATTGACAGCGCGTCAGGCACACTG
CCTGACGGCACCGTCTTTTCTATCCCCGACCAGGACGCACTGCCCGATCCGCTGCACCCGCAAAATTTTC
CGGACGAAAGAAGCCGCAATATTTACCTCGCTCTGCCGGTCGCCAGTGATGTGAGAAATGAAATCAGCGA
CGGGCGGCGAATCGGGCGTTACCGGCTGAATTATGCCGATGTCCGGGATCTGCATTCAGAAGAAGGCGAC
GCGCGAACACTGACGCTGGGACAACTGACGCCGCGCATTATGAGCGGTGCAGAAGATATGAGTGCCTATA
TTACGCTCCCGCTTTGCCGTATCAGCGATCGCCATGCCGACGGCTCCCTGACGCTGGATGACGATTTTAT
CCCCTCCTGCCAGAATATTCAGGTCAGTAAGAAACTGCGTGTTTATCTCAAAGAGGTACAGGGGGCCATT
GGCGGACGGGCAAGCGATCTGGCAAACCGTATTGGCTCTCCGGCGCAGAGCGGCATCGCGGATGTGGCGG
AATTTATGATGTTGCAGTTGCTTAACCGTAACCAGACCCGGTTTACCCATCGCGCCCGCCGATCCCAGCT
CCACCCGGAAGATTTCTACCTTGATCTTGCCGAGTTGCTGGGTGAACTGATGACCTTTACAGAGCCGTCA
CGCCTGCCCTGCCCGCTTGATGTGTATGATCATCATGACCTGACCAAAACATTTAAAACACTGTTACCGG
AAGTCAAACGGGCGCTGCATACCGTACTGTCGCCAAGAGCGGTCAATCTGCCGCTGCATCTGCGTGACGG
CATCTGGCAGGCCGATGTTCATGACTCGGAACTGCTACAGTCTGCCACCTTTGTACTGGCCGTGGCAGCA
AATATGCCTGTCGATCAGATCCAGCGTCAGTTTATCCAGCAGTCGAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGTGTGCAGATCCCGGGTATTCCTCTGCGCGCACTGATGGTGGCCCCCCGCCAGCTTCC
CTACCATTCCGGGTTCAGCTATTTCGAACTCGACAAGAGCGGCCAGGCCTGGACAGAAATGGCTGCCGCC
GGGGCCGTTGCACTGCATGTATCCGGCAGTTTCCCGGATCTGAACATGCAACTGTGGGCGATAAGAGGGT
AA