SecReT6
Protein ID: 15829481
SecReT6 ID8
T6SS typei1
Gene symbol-
Locus tagECs0227
StrainEscherichia coli O157:H7 str. Sakai
Repliconchromosome [GenBank: NC_002695] [Browse all T6SS(s) in this replicon]
Location [Strand]256526..257806 [-]
Producthypothetical protein
NoteFha
UniProt IDQ7AHI9
KEGG IDecs:ECs0227
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 426 a.a.     [Download]
>gi|15829481|ref|NP_308254.1| hypothetical protein ECs0227 [Escherichia coli O157:H7 str. Sakai]
MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSVQDRQQSIPAQAFTVILHDGTFCLRP
QTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLST
EGAPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMD
LPPIYASPGDHNDDISAAEMAQRHLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGLLDLQQQ
RNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRV
LLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|15829254|ref|NC_002695.1|:c257806-256526 Escherichia coli O157:H7 str. Sakai chromosome, complete genome
ATGCCGGAAGAGAAACTACAGACGCTTTCATTGCAGGTCATTAACGGCAGTGAGCTGGAAAGCGGGCGGG
CGGCGCGCTGTCTGTTCACACAGCAGGGAAATGTCGGCCATGCCCCCGAATGCCACTGGTCGGTACAGGA
TCGTCAGCAGAGCATTCCGGCCCAGGCTTTTACCGTTATCCTGCACGATGGCACATTTTGTCTACGCCCG
CAGACGGCACAACTGTGGCTGAATCAGGCAAAAGTCACAGCAACATCAGACCTGATACAGTTGCGCCAGG
GCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCGGGGAGATATTCCCCATTACGA
TGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTCACGGATACCCTGCTATCAACG
GAGGGTGCGCCACACTATCCGGGAATGACTCACCGGCACCAGCTTGCAGACACCGTGGTAAATGGTTTTT
CTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGGCGATCCGCTTTCAGGCATTGC
GGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGGATCAATACTCCGTTTATGGAT
CTGCCGCCCATTTATGCCAGCCCTGGCGATCATAATGATGACATCTCTGCGGCAGAAATGGCGCAACGCC
ACCTTGCGGTCACCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCGTGAGCAATTCCGACGATGCGGA
TGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGTCTGCTCGATTTGCAGCAGCAG
CGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAACATGGATTACG
CCACCGCGCTCGACGTGATGTTTGCCGAAGGTAAAAGCCCGGTACATCTGGCGGCTCCCGCCGCCGTCAG
TGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCGGCGATTGTGGAGTCGCTTCGTGTC
CTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGTACCGCCGCAGCCATGAACTGC
GCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTACGAAGAACTGGCCTCCGATCG
CCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAGGTCTATGACCGGGTGCTTCGTGAAAAA
CAGCGGGAGCCGGAAGCATGA