SecReT6
Protein ID: 15829487
SecReT6 ID8
T6SS typei1
Gene symbol-
Locus tagECs0233
StrainEscherichia coli O157:H7 str. Sakai
Repliconchromosome [GenBank: NC_002695] [Browse all T6SS(s) in this replicon]
Location [Strand]262936..263436 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ8X7T5
KEGG IDecs:ECs0233, ece:Z0264
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.70E-55, Aligned region: 7..162
Protein Sequence: 166 a.a.     [Download]
>gi|15829487|ref|NP_308260.1| hypothetical protein ECs0233 [Escherichia coli O157:H7 str. Sakai]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSSLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDEMNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGQVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|15829254|ref|NC_002695.1|:c263436-262936 Escherichia coli O157:H7 str. Sakai chromosome, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAACGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCTCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACCGTCCCCGCCACGCTGAAGGGAAGCACAACGGACGATGAAATGAATG
TGGCGCTGAATATCAAGTCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGCCAGGTGA
GCAATAAATAA