SecReT6
Protein ID: 15829491
SecReT6 ID8
T6SS typei1
Gene symbol-
Locus tagECs0237
StrainEscherichia coli O157:H7 str. Sakai
Repliconchromosome [GenBank: NC_002695] [Browse all T6SS(s) in this replicon]
Location [Strand]267078..271292 [+]
ProductRhsG core protein with extension
NotePAAR
UniProt IDQ7AHI0
KEGG IDecs:ECs0237
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 229..243
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 325..361
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 353..384
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 434..472
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 458..492
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 498..537
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 542..577
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 584..620
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 626..661
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 667..697
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 692..718
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 729..762
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 784..806
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 870..903
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 950..987
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 1002..1013
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 1035..1048
RHS_repeat [PF05593], Evalue: 1.90E-66, Aligned region: 1170..1188
RHS [PF03527], Evalue: 2.00E-18, Aligned region: 625..635
RHS [PF03527], Evalue: 2.00E-18, Aligned region: 949..958
RHS [PF03527], Evalue: 2.00E-18, Aligned region: 1149..1189
Protein Sequence: 1404 a.a.     [Download]
>gi|15829491|ref|NP_308264.1| RhsG core protein with extension [Escherichia coli O157:H7 str. Sakai]
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITYANPVNPVLGAKVLPGETDLALPGPL
PFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDNGGRSIHFEPLFPGEISYSRSESFW
LARGGVAEQHSSQPLSALWQVLPEDVRLSPHMYLATNSLQGPWWILNWPERVPGADEVLPPEPPAYRVLT
GVVDGFGRTLAFHRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSL
VFPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGTQVRGFAYDAE
HAGRMVAHHYAGRPESRYRYDDTGRVTELVNPEGLDYRFEYGQDRVTITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPD
GLRSSREYDEKGRLAAETSRSGETTRYSYDDPASELPTGIQDATGSTKQMAWSRYGQLLTFTDCSGYTTR
YEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIVAPDGSRSEIQYDAWG
KAVSTTQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKLTQSEDE
GLVTLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVENPE
TGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVEYMRDRLHRETARSFGGE
AYELATAWNTSGQLRSRHLNLPQLDRDYDWNDNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDI
PYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHY
DSQHRLVFHTRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTVQT
QQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGRLERELRQGSVSEE
SQQWLAQCGLTAEQMGAQLEAGYIPERKLHLYHCDQRGLPLGLISPGRETALTAEYDEWGNLLSETSAQP
LQQSLRFPGQQYDEESGLYYNRNRYYDPLQGRYITQDPIGLEGGWNLYQYPLNPIEHIDPLGLALDLNYY
SPSDPIYKGSLNVREFPTGFTVGGHGSPTSMSDDRIKKGSDLTIKQLASDIRANPKYHEGMPVVLFSCET
GKGKNSFAQKLANELDATVIAPDEIIWIWPDGNYAIMGQTARITIGGKDNGVFELVPDEKQPGDFHKFTP
TGSK
 
Nucleotide Sequence: 4215 bp     [Download]
>gi|15829254|ref|NC_002695.1|:267078-271292 Escherichia coli O157:H7 str. Sakai chromosome, complete genome
ATGGGAGGAAAACCGGCGGCGCGGCAGGGTGACATGACCCGCAAGGGACTGGATATTGTGCAGGGTTCAG
CAGGGGTGCTGATAGGTGCGCCGACGGGCGTGGCCTGCTCGGTGTGTCCGGGAGGGATTACCTATGCTAA
CCCGGTGAACCCGGTGCTGGGTGCGAAGGTGCTGCCGGGCGAGACGGACCTTGCGCTGCCCGGCCCGCTG
CCGTTTATTCTTTCCCGCGCCTACAGCAGCTACCGGACCAGAACACCCGCGCCGGTGGGGGTGTTTGGTC
CCGGCTGGAAAGCGCCCTTCGATATCCGCTTACAGATACGCGATGAAGGCCTGATACTCAACGACAACGG
CGGCAGGAGCATTCACTTTGAGCCGCTGTTTCCCGGCGAGATAAGCTACAGCCGCAGCGAGTCGTTCTGG
CTGGCGCGGGGCGGGGTGGCGGAGCAGCACAGTTCGCAGCCGCTAAGCGCGCTCTGGCAGGTGCTGCCGG
AAGATGTTCGCCTGAGTCCGCATATGTACCTGGCGACAAACAGCCTTCAGGGGCCGTGGTGGATACTCAA
CTGGCCGGAGCGGGTGCCGGGGGCGGACGAGGTGCTGCCGCCGGAGCCGCCCGCATACCGGGTGCTGACG
GGCGTGGTGGATGGCTTCGGGCGGACGCTGGCCTTTCACCGGGCGGCGGAGGGTGATGTGGCGGGCGCGG
TGACGGGGGTGACGGACGGCGCGGGCCGCCGTTTTCACCTGGTGCTGACCACACAGGCACAGCGGGCGGA
AGTATTCCGTAAACAGCGCGCCACGTCTTTATCTTCCCCTGCCGGTCCCCGTTCTGCTTCCTCTTCTCTG
GTTTTCCCCGACACGCTGCCCGCCGGTACAGAATACGGTGCCGATAACGGTATCCGGCTGGAGGCGGTAT
GGCTGACACACGACCCGGCATACCCGGATGAACTGCCCGCCGCGCCGCTGGCGCGCTACACGTACACGGC
CAGCGGAGAACTGCGGGCGGTGTATGACCGCAGCGGGACGCAGGTGCGCGGGTTTGCTTATGATGCGGAG
CACGCCGGGCGGATGGTGGCGCACCATTATGCGGGTAGGCCGGAGAGCCGCTACCGGTATGATGATACCG
GCCGGGTGACGGAGCTGGTCAACCCGGAGGGGCTGGACTACCGCTTTGAGTACGGGCAGGACCGTGTGAC
CATCACGGACAGCCTGAACCGGCGGGAGGTGCTGTACACGGAAGGCGAGGGTGGCCTGAAACGTGTTGTG
AAGAAGGAACATGCGGACGGGAGCATCACCCGCAGCGAGTATGATGAGGCGGGGAGGCTGAAGGCACAGA
CGGATGCGGCGGGACGGCGGACGGAGTACAGCCTGCATATGGCGTCGGGTGCGGTGACAGCGGTGACGGG
GCCGGACGGCAGGACGGTGCGGTATGGCTATAACAGCCAGCGGCAGGTGACGTCAGTGACGTACCCGGAC
GGGCTGCGCAGCAGCCGGGAGTATGATGAGAAGGGAAGGCTGGCGGCGGAGACCTCGCGCAGCGGAGAGA
CGACGCGGTACAGCTATGATGACCCGGCGAGTGAGCTGCCGACAGGGATACAGGACGCGACGGGCAGTAC
AAAACAGATGGCATGGAGCCGTTACGGTCAGCTGCTGACCTTTACGGACTGCTCGGGGTACACGACGCGG
TATGAGTATGACCGGTACGGTCAACAAATCGCCGTTCACCGGGAAGAAGGCATCAGCACTTACAGCAGTT
ATAACCCGCGTGGCCAACTGGTCAGTCAGAAGGATGCGCAGGGGCGTGAAACCCGTTATGAGTACAGCGC
CGCAGGCGACCTCACCGCTATCGTTGCCCCGGACGGCAGCCGCAGTGAGATACAGTATGATGCGTGGGGA
AAGGCCGTCAGCACCACGCAGGGCGGTCTGACGCGCAGCATGGGGTATGACGCTGCCGGGCGCATCACCG
TGCTGACCAACGAGAACGGCAGCCAGTCCACGTTCCGGTATGACCCGGTGGACAGGCTGACTGAACAGCG
CGGTTTTGATGGCCGGACGCAACGTTACCACTATGACCTGACCGGAAAACTCACGCAGAGTGAAGACGAG
GGGCTTGTCACCCTCTGGCACTACGATGCGTCGGACCGCATCACGCACCGGACGGTGAACGGCGACCCGG
CAGAGCAGTGGCAGTATGATGAGCACGGGTGGCTAACCACCCTCAGCCATACCAGTGAAGGCCACCGGGT
GTCGGTCCACTACGGCTATGACGATAAAGGCCGCCTGACGGGTGAACGGCAGACGGTGGAGAACCCGGAG
ACGGGGGAGATGCTGTGGGAGCATGAGACGGGGCACGCGTACAGCGAACAGGGGCTGGCGACCCGTCAGG
AGCCGGACGGTCTGCCGCCGGTAGAGTGGCTGACGTATGGCAGCGGTTATCTTGCGGGGATGAAGCTGGG
CGGAACGCCACTGGTCGAGTACATGCGGGACCGGCTGCACCGTGAGACGGCCCGCAGCTTCGGCGGGGAG
GCATATGAACTTGCCACCGCCTGGAATACCAGCGGCCAGCTCCGGAGCAGGCACCTGAACCTTCCGCAGC
TTGACCGTGACTACGACTGGAACGACAACGGACAGCTAATCCGCATCAGCGGCCCGCAGGAGAGCCGGGA
GTACCGTTACAGTGACACGGGAAGGCTGACGGGCGTCCACACCACGGCAGCGAACCTGGATATCGATATC
CCGTATGCAACGGACCCGGCAGGAAACCGGCTGCCGGACCCGGAACTGCACCCGGACAGCACCCTCACGG
CATGGCCGGATAACCGCATCGCGGAAGATGCGCACTATGTCTACCGCTACGATGAATACGGCAGGCTGGC
GGAGAAGACGGACCGCATCCCGGAAGGGGTTATCCGGATGCACGACGAGCGCACCCACCACTATCACTAC
GACAGCCAGCACCGCCTGGTGTTCCACACGCGGATACAGCACGGCGAACCACAGGTGGAGAGCCGGTACC
TCTATGACCCGCTGGGCCGCCGGACGGGAAAACGGGTGTGGCGGCGGGAGCGTGACCTGACGGGGTGGAT
GTCGCTGTCGCGTAAACCGGAGGAGACCTGGTACGGGTGGGACGGTGACAGGCTGACCACTGTACAGACC
CAACAGACAAGAATCCAGACGGTATACCAGCCGGGAAGCTTCACGCCGCTCCTGAGAATCGAAACAGAGA
ATGGTGAACAGGCGAAGGCGCGGCACCGTAGCCTGGCGGAGGTGTTGCAGGAGGACACGGGTGTGACGCT
ACCGGCGGAGCTGGCGGTGATGCTGGGAAGGCTGGAGCGGGAGCTGCGGCAGGGCAGCGTGAGTGAAGAA
AGCCAGCAGTGGCTTGCGCAGTGCGGGCTGACGGCGGAGCAGATGGGCGCGCAGCTGGAGGCGGGATACA
TCCCGGAGAGGAAACTTCATCTTTACCACTGCGACCAACGGGGACTGCCGCTGGGGCTCATCAGCCCGGG
AAGGGAGACGGCGTTGACTGCGGAGTATGACGAGTGGGGAAACCTGCTGAGCGAAACCAGCGCGCAGCCC
CTTCAACAGTCACTCCGTTTCCCGGGCCAGCAGTATGATGAGGAGTCGGGGCTGTACTACAACCGCAACC
GGTACTATGATCCGTTGCAGGGGAGATATATCACCCAGGACCCGATAGGGCTGGAGGGGGGATGGAACCT
GTATCAGTACCCACTCAATCCTATTGAACATATAGATCCGTTGGGGTTAGCACTTGATTTGAATTATTAT
TCTCCGTCAGATCCTATATATAAAGGTTCTCTTAATGTAAGGGAATTTCCAACGGGTTTTACAGTTGGAG
GTCATGGTTCGCCTACATCTATGAGTGATGACAGAATCAAAAAAGGAAGTGATCTGACAATAAAACAATT
AGCTAGCGACATAAGAGCGAATCCTAAATATCATGAAGGTATGCCTGTAGTCTTGTTTTCCTGCGAAACA
GGAAAAGGCAAAAATTCATTTGCACAGAAACTAGCTAACGAACTTGATGCTACAGTGATTGCTCCTGATG
AAATAATATGGATTTGGCCGGATGGAAACTATGCTATTATGGGGCAAACAGCTAGGATAACAATAGGCGG
TAAGGACAACGGGGTGTTTGAATTGGTGCCAGACGAGAAACAACCAGGGGACTTTCATAAGTTTACACCT
ACAGGAAGCAAATAG