SecReT6
Protein ID: 158424210
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2586
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2912176..2912775 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA8IAZ5
KEGG IDazc:AZC_2586
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.60E-33, Aligned region: 43..174
Protein Sequence: 199 a.a.     [Download]
>gi|158424210|ref|YP_001525502.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MRPAMWECPLSEREVPETQVRPTILAGSGAVLARRTFVAGGLAGLAGCGAIPTPPPKPTIIGVRLLADDT
INPSLVGVASPVTVRLYVLKDDTNFMQSDFQTLWSQDAQILGPSMVSKKEIVVPPNGNIPVKEEAPPDAT
LVGAIAAFRTIDQAQWRTTIGLKPSLVNDVQLNLVGLTAQFIPVVVGWKGDPTPPLFPF
 
Nucleotide Sequence: 600 bp     [Download]
>gi|158421624|ref|NC_009937.1|:c2912775-2912176 Azorhizobium caulinodans ORS 571 chromosome, complete genome
GTGCGGCCGGCTATGTGGGAGTGCCCCTTGTCTGAACGAGAAGTGCCGGAAACGCAGGTCCGACCGACGA
TCCTTGCGGGGTCCGGGGCGGTGCTCGCGCGGCGCACGTTCGTTGCCGGCGGGCTTGCGGGTCTCGCCGG
CTGCGGCGCCATTCCCACCCCGCCGCCCAAGCCGACCATCATCGGCGTGCGGCTTCTGGCTGACGACACG
ATCAATCCGAGCCTCGTGGGCGTGGCCTCGCCGGTGACCGTCCGGCTCTATGTCCTGAAGGACGATACCA
ATTTCATGCAGAGCGACTTCCAGACGCTCTGGTCGCAGGACGCGCAGATCCTCGGTCCCAGCATGGTCTC
CAAGAAGGAGATCGTGGTGCCGCCGAACGGCAACATTCCGGTCAAGGAGGAGGCGCCGCCCGATGCCACG
CTCGTCGGCGCCATCGCGGCCTTCCGCACCATCGACCAGGCACAGTGGCGCACCACCATCGGCCTGAAGC
CCAGTCTCGTGAACGACGTGCAGCTCAATCTCGTCGGGCTGACCGCGCAGTTCATTCCCGTGGTGGTCGG
CTGGAAGGGCGATCCGACGCCGCCCCTCTTCCCCTTCTGA