SecReT6
Protein ID: 158424211
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2587
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2912996..2915635 [+]
ProductATPase
NoteTssH
UniProt IDA8IAZ8
KEGG IDazc:AZC_2587
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.10E-39, Aligned region: 611..776
AAA_2 [PF07724], Evalue: 3.10E-39, Aligned region: 831..849
AAA [PF00004], Evalue: 2.50E-17, Aligned region: 230..361
AAA [PF00004], Evalue: 2.50E-17, Aligned region: 616..742
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 230..250
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 331..360
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 615..736
ClpB_D2-small [PF10431], Evalue: 1.50E-12, Aligned region: 212..224
ClpB_D2-small [PF10431], Evalue: 1.50E-12, Aligned region: 729..748
ClpB_D2-small [PF10431], Evalue: 1.50E-12, Aligned region: 783..857
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 207..251
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 274..308
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 497..541
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 584..636
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 680..703
AAA_16 [PF13191], Evalue: 1.50E-11, Aligned region: 776..843
AAA_22 [PF13401], Evalue: 9.10E-08, Aligned region: 229..315
AAA_22 [PF13401], Evalue: 9.10E-08, Aligned region: 614..646
Sigma54_activat [PF00158], Evalue: 1.30E-07, Aligned region: 213..244
Sigma54_activat [PF00158], Evalue: 1.30E-07, Aligned region: 614..738
NACHT [PF05729], Evalue: 8.00E-05, Aligned region: 230..258
NACHT [PF05729], Evalue: 8.00E-05, Aligned region: 615..643
Clp_N [PF02861], Evalue: 0.00013, Aligned region: 30..79
Clp_N [PF02861], Evalue: 0.00013, Aligned region: 119..132
Zeta_toxin [PF06414], Evalue: 0.00016, Aligned region: 230..250
Zeta_toxin [PF06414], Evalue: 0.00016, Aligned region: 420..510
Zeta_toxin [PF06414], Evalue: 0.00016, Aligned region: 614..656
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 228..254
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 613..637
AAA_25 [PF13481], Evalue: 0.00048, Aligned region: 228..263
AAA_25 [PF13481], Evalue: 0.00048, Aligned region: 613..643
AAA_25 [PF13481], Evalue: 0.00048, Aligned region: 677..699
IstB_IS21 [PF01695], Evalue: 0.0006, Aligned region: 223..249
IstB_IS21 [PF01695], Evalue: 0.0006, Aligned region: 615..635
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 230..320
AAA_14 [PF13173], Evalue: 0.0012, Aligned region: 614..696
Torsin [PF06309], Evalue: 0.0012, Aligned region: 571..639
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 231..251
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 616..638
RNA_helicase [PF00910], Evalue: 0.0031, Aligned region: 713..733
AAA_17 [PF13207], Evalue: 0.0033, Aligned region: 230..244
AAA_17 [PF13207], Evalue: 0.0033, Aligned region: 615..653
AAA_29 [PF13555], Evalue: 0.0044, Aligned region: 220..245
AAA_29 [PF13555], Evalue: 0.0044, Aligned region: 613..626
TIP49 [PF06068], Evalue: 0.0048, Aligned region: 230..250
TIP49 [PF06068], Evalue: 0.0048, Aligned region: 280..310
TIP49 [PF06068], Evalue: 0.0048, Aligned region: 580..651
Arch_ATPase [PF01637], Evalue: 0.0048, Aligned region: 208..246
Arch_ATPase [PF01637], Evalue: 0.0048, Aligned region: 283..314
Arch_ATPase [PF01637], Evalue: 0.0048, Aligned region: 614..654
Protein Sequence: 879 a.a.     [Download]
>gi|158424211|ref|YP_001525503.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
METRMAAVDLKALIGRLDGTCRSTLEGAAGFALMRTHYNVEMEHWLSRLLAEANTDIPLILAHYGVELGA
VERDIARSLDRLKTGNSRPPGLSPDIVETAKQAWLLASIEGGLSQARSGHLLWAMLSDSSLALKLNDMSA
GFKTLSADALQKDFASITAGSSEQQAALAQPAPGFAAPGTGGKAGDALAQYTVDLTAEAKAGRIDPIIGR
DSEIRQIVDILIRRRQNNPILTGEAGVGKTAVVEGFALRIAAGDVPPALRNVVLRTLDLGLLQAGASMKG
EFESRLRAVIDGVKASPVPIILFIDEAHTLIGAGGAAGQGDAANLLKPALARGELRTIAATTWAEYKKYF
EKDAALTRRFQVVKVEEPSEPIAIAMLRGLVPTLEGYHKVRILDEALSEAVRLSARFIPSRQLPDKGVSL
LDTACSRVAVSQTTIPAAIDDRNRRIELIDAEMVLITREQASGVDHTKRAETLAAERATLDAERITLTER
WEAELALVKSLGDLRTQLEAEAEATAHDALRVKYAEESAKLAELQGEAPLVFPLVDGQAIAEVVENWTGI
PAGRMRSDEIRNVLGLQATMEQRVVGQSHAIAAVAQAIRTSRAGMTDPRKPLGVFLMVGPSGVGKTETAL
TLADQLYGGEQNLTTINMSEYKEEHKVSLLMGSPPGYVGYGEGGVLTEAVRRRPYSVILLDEMEKAHPGV
QDIFFQVFDKGSMKDGEGREIDFKNTVIIMTSNAASDLITKLCADPETMPEPGVLAQALRPELEKYYKAA
FLGRVTLVPYLPLTDAIIRQIVVLQLGRIRNRVMEAYGASFTYAPELVETIAARCTESASGARNIENILS
RTLLPELSGHLLEAMAQAKPITAISVGLKEDGQFSYQLQ
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2912996-2915635 Azorhizobium caulinodans ORS 571 chromosome, complete genome
GTGGAGACAAGAATGGCTGCGGTTGACCTCAAGGCTCTGATCGGCCGCTTGGATGGCACCTGCCGCTCGA
CCTTGGAGGGGGCAGCCGGCTTCGCCCTCATGCGCACCCACTACAATGTGGAGATGGAGCACTGGCTCTC
GCGCCTGCTGGCGGAAGCCAATACGGACATCCCGCTCATTCTCGCTCATTACGGTGTCGAGCTCGGCGCC
GTGGAACGGGACATCGCCCGCAGCCTCGACCGGCTGAAGACCGGCAACAGCCGCCCGCCGGGCCTCTCGC
CGGACATCGTGGAGACGGCCAAGCAGGCCTGGCTGCTGGCTTCCATCGAAGGCGGCCTGTCCCAGGCGCG
GTCCGGCCACCTGCTCTGGGCCATGCTCTCGGACAGCTCGCTGGCGCTGAAGCTCAACGACATGTCGGCG
GGCTTCAAGACGCTCTCCGCCGACGCGCTGCAAAAGGACTTCGCCAGCATCACCGCCGGCTCAAGCGAGC
AGCAGGCGGCCCTCGCGCAGCCCGCCCCCGGCTTCGCGGCTCCCGGAACCGGCGGCAAGGCGGGCGATGC
GCTGGCGCAGTACACGGTGGACCTGACCGCCGAAGCCAAGGCGGGTCGGATCGACCCGATCATCGGGCGC
GATTCAGAGATCCGCCAGATCGTCGACATCCTCATCCGCCGCCGGCAGAACAATCCGATCCTCACGGGCG
AGGCGGGCGTCGGCAAGACGGCGGTCGTGGAAGGCTTTGCGCTGCGCATCGCCGCCGGCGACGTGCCTCC
GGCCCTGCGCAACGTTGTCCTGCGCACCCTCGACCTCGGCCTGCTCCAGGCCGGCGCCAGCATGAAGGGC
GAGTTCGAGAGCCGGCTCCGGGCGGTGATCGACGGCGTGAAGGCCTCGCCCGTTCCGATCATCCTCTTCA
TCGACGAGGCGCACACCCTGATCGGCGCCGGCGGTGCGGCGGGACAAGGCGATGCCGCCAACCTGCTGAA
GCCGGCCCTCGCCCGTGGCGAACTGCGGACCATCGCGGCCACCACGTGGGCCGAATACAAGAAATATTTC
GAGAAGGACGCCGCCCTCACCCGCCGCTTCCAGGTGGTGAAGGTGGAAGAACCCTCCGAGCCCATCGCCA
TTGCCATGCTGCGCGGCCTCGTGCCCACGCTGGAGGGCTATCACAAGGTCCGCATCCTCGATGAGGCGCT
GAGCGAGGCCGTGCGCCTGTCCGCCCGCTTCATTCCTTCGCGCCAGCTGCCGGACAAGGGCGTCTCGCTG
CTCGACACCGCCTGCTCACGGGTCGCCGTAAGCCAGACTACCATTCCCGCCGCCATCGACGACCGCAACC
GGCGGATCGAGCTGATCGACGCCGAGATGGTGCTCATCACCCGCGAGCAGGCCTCCGGCGTCGATCACAC
CAAGCGTGCGGAGACGCTGGCCGCCGAGCGGGCCACCCTCGATGCCGAGCGCATTACGCTCACCGAGCGC
TGGGAAGCGGAGCTGGCGCTCGTGAAGTCTCTGGGCGACCTGCGCACGCAGCTGGAAGCCGAGGCGGAGG
CCACCGCGCATGACGCGCTGCGGGTGAAATATGCCGAGGAGAGCGCCAAGCTCGCCGAATTGCAGGGCGA
GGCGCCGCTGGTCTTCCCACTGGTCGATGGCCAGGCCATCGCGGAAGTGGTGGAGAACTGGACCGGCATT
CCAGCCGGCCGGATGCGCAGCGACGAGATCCGCAACGTCCTCGGCTTGCAGGCGACCATGGAACAGCGGG
TGGTCGGCCAGTCCCACGCCATCGCGGCGGTGGCGCAGGCCATCCGCACGTCGCGGGCCGGCATGACAGA
CCCTCGCAAGCCGCTGGGCGTCTTCCTGATGGTCGGCCCCTCGGGCGTCGGCAAGACGGAGACCGCGCTG
ACGCTGGCGGACCAGCTCTATGGCGGTGAGCAGAACCTCACCACCATCAACATGTCTGAATATAAGGAAG
AGCATAAGGTCAGCCTGCTCATGGGCAGCCCGCCCGGCTATGTCGGCTATGGCGAGGGCGGCGTGCTCAC
CGAGGCGGTGCGCCGGCGGCCCTATTCGGTCATTCTCCTCGACGAGATGGAGAAGGCCCATCCGGGCGTG
CAGGACATCTTCTTCCAAGTGTTCGACAAGGGGTCGATGAAGGACGGCGAAGGCCGGGAGATCGACTTCA
AGAACACCGTCATCATCATGACGTCCAACGCCGCATCGGACCTCATCACCAAGCTCTGCGCCGATCCCGA
GACCATGCCCGAGCCGGGCGTGCTGGCGCAGGCGCTGCGGCCGGAGCTCGAGAAATACTACAAGGCCGCC
TTCCTCGGCCGCGTGACGCTGGTGCCCTATCTGCCGCTGACGGATGCCATCATCCGCCAGATCGTGGTGC
TCCAGCTCGGCCGCATCCGCAACCGGGTGATGGAAGCCTATGGCGCGAGCTTCACCTACGCGCCGGAGCT
GGTGGAAACCATCGCGGCGCGCTGCACCGAAAGCGCCTCGGGCGCGCGCAACATCGAGAACATCCTGTCG
CGGACGCTGCTGCCCGAACTCTCCGGCCACCTACTGGAAGCCATGGCGCAGGCGAAGCCCATCACCGCGA
TCAGTGTCGGGCTGAAGGAGGACGGCCAGTTCTCCTATCAGTTGCAGTGA