SecReT6
Protein ID: 158424213
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2589
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2917166..2917645 [+]
Producthypothetical protein
NoteTssD
UniProt IDA8IB02
KEGG IDazc:AZC_2589
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.40E-34, Aligned region: 5..134
Protein Sequence: 159 a.a.     [Download]
>gi|158424213|ref|YP_001525505.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MVAIYVKYDGIDGEATHQDHKKWIDVLSLSWGVGRGISTVSGSGNNREASEPSISEVSIVKMFDASSPKL
FTEACTGNTGKTVKIDLTTTGSPGATYCTYTLTNALISSYSVSSGGDRPTESISISFTKLEFKFTPYDDK
NKAGTPVTVSYDLATTKSA
 
Nucleotide Sequence: 480 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2917166-2917645 Azorhizobium caulinodans ORS 571 chromosome, complete genome
GTGGTGGCCATATACGTTAAATATGACGGCATCGACGGCGAAGCCACGCATCAGGACCACAAGAAGTGGA
TCGACGTCCTTTCGCTCTCCTGGGGCGTCGGGCGCGGAATCTCCACCGTCTCGGGTTCGGGCAACAACCG
CGAGGCCTCGGAGCCCTCCATCAGCGAAGTGTCCATCGTCAAGATGTTCGATGCGTCCTCGCCCAAGCTC
TTCACGGAGGCCTGCACGGGCAACACCGGCAAGACCGTGAAGATCGACCTCACCACCACCGGCAGCCCCG
GCGCGACCTACTGCACCTACACGCTGACCAACGCGCTGATCTCGTCCTACTCGGTGTCCTCGGGCGGCGA
CCGCCCCACCGAGTCCATCTCGATCAGCTTCACCAAGCTCGAGTTCAAGTTCACCCCCTACGACGACAAG
AACAAGGCCGGCACCCCGGTCACCGTGTCCTACGACCTCGCCACCACCAAGAGCGCGTAA