SecReT6
Protein ID: 158424215
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2591
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2919813..2920289 [+]
Producthypothetical protein
NoteTssD
UniProt IDA8IB07
KEGG IDazc:AZC_2591
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.90E-35, Aligned region: 4..133
Protein Sequence: 158 a.a.     [Download]
>gi|158424215|ref|YP_001525507.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MAIYVKYDGIDGEATQQDHKKWIDVLSLSWGVGRGISTVSGSGNNREASEPSISEVSIVKMFDASSPKLF
TEACTGNTGKTVKIDLTTTGSPGATYCTYTLTNALISSYSVSSGGDRPTESISISFTKLEFKFTPYDDKN
KAGTPVTVSYDLATTKSS
 
Nucleotide Sequence: 477 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2919813-2920289 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGGCCATCTACGTTAAATATGACGGCATCGACGGCGAAGCCACGCAGCAGGACCACAAGAAGTGGATCG
ACGTCCTCTCGCTCTCCTGGGGCGTCGGGCGCGGCATCTCCACCGTCTCGGGCTCCGGCAACAACCGCGA
GGCCTCCGAGCCCTCCATCAGCGAAGTGTCCATCGTCAAGATGTTCGATGCGTCCTCGCCCAAGCTCTTC
ACGGAGGCCTGCACGGGCAACACCGGCAAGACCGTGAAGATCGACCTCACCACCACCGGCAGCCCGGGCG
CGACCTACTGCACCTACACGCTGACCAACGCGCTGATCTCGTCCTACTCGGTGTCCTCGGGCGGCGACCG
CCCCACCGAGTCCATCTCGATCAGCTTCACCAAGCTCGAGTTCAAGTTCACCCCCTACGACGACAAGAAC
AAGGCCGGCACCCCGGTCACCGTGTCCTACGATCTCGCCACCACCAAGAGCTCGTGA