SecReT6
Protein ID: 158424216
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2592
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2920501..2922543 [+]
Producthypothetical protein
NoteTssI
UniProt IDA8IB09
KEGG IDazc:AZC_2592
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-73, Aligned region: 33..334
Phage_GPD [PF05954], Evalue: 4.30E-73, Aligned region: 462..556
Phage_base_V [PF04717], Evalue: 3.00E-26, Aligned region: 91..101
Phage_base_V [PF04717], Evalue: 3.00E-26, Aligned region: 373..466
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 87..91
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 518..539
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 542..557
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 560..576
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 578..599
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 604..610
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 625..631
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 647..660
Gp5_C [PF06715], Evalue: 0.00038, Aligned region: 663..679
Protein Sequence: 680 a.a.     [Download]
>gi|158424216|ref|YP_001525508.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MSDASAPVQTDRLLTLTTPLGGDVLIATHLEGKEGLSELFLFTLTMTSTKADITPDSLLGKPITVAIARP
GGDPRYINGIVTRFQAGDRTVDGMRRYRVELSPKLWLLTRTSDCRIFQNQSVVQIADTLLSEGGITDYKK
QGLSGSHPSRDYCVQYRETDYAFLQRIFAEEGIYFYFQYDSSSHTLVLSDSTAGYVDSIDKSVIHAPVTT
GETIAVQEWASGFHFRSGKATLNDYNFEQPANDLTASTTTVLDNSAFKSWELYDYPGDYDTKDKGTPLSR
LRMEAEEVDYAVSPGASTYAGFLPGAKFTMSKHEVVSEQGRSYALRTVEHSAQDLSHLGNQSGSVFYRNR
FTALPAATAFRPPRITRRPLIPGPQTALVVGPSGEEIYCDKYGRIRLQFYWDRLGKKDENSSCWVRVAQS
LAGSSWGTQFTPRIGMEVVVIFLEGDPDRPLVVSAVYNGQNMPPYTLPDNKTQSGIKTRSSPQGSASTFN
ELRFEDKKDSELVYMHAQKDFTREVTNDDTLTVSHDQTITIKNNRTETVQEGNESVTISKGNRTLTVSEG
NDSLTVTKGNRSATISEGNDTLTLAKGNVTTTLNGGNHTLKLDSGNATMQCDGGSITLQAAQTITLKVGG
NSITISQSGISLSGTQITISGSAKVQVSGSMVNVSGDGTVQVKGGLVTIN
 
Nucleotide Sequence: 2043 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2920501-2922543 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGAGTGACGCTTCAGCCCCCGTGCAGACCGACCGGCTGCTGACGCTCACCACGCCGCTCGGCGGCGATG
TGCTCATCGCCACGCACCTCGAGGGCAAGGAAGGCCTGTCCGAGCTCTTCCTGTTCACCCTCACCATGAC
GTCCACGAAGGCCGACATCACGCCGGACAGCCTTCTCGGCAAGCCGATCACCGTGGCCATCGCCCGGCCC
GGCGGCGATCCGCGCTACATCAACGGCATCGTCACGCGCTTTCAGGCCGGGGACCGCACGGTGGACGGCA
TGCGCCGATACCGGGTCGAACTCTCGCCCAAGCTCTGGCTGCTCACCCGCACGTCCGACTGCCGCATCTT
CCAGAACCAGAGCGTGGTGCAGATCGCCGACACGCTGCTCTCGGAGGGCGGCATCACCGACTACAAGAAG
CAGGGCCTCTCCGGCAGCCACCCCAGCCGCGATTACTGCGTTCAGTATCGCGAGACGGACTATGCCTTCC
TCCAGCGCATCTTCGCGGAGGAGGGCATCTATTTCTATTTCCAGTACGACTCTTCCAGCCACACGCTGGT
GCTGAGCGACAGCACGGCCGGCTATGTGGATTCAATCGACAAGTCGGTCATCCACGCCCCCGTCACCACC
GGCGAGACCATCGCCGTGCAGGAATGGGCGAGCGGCTTCCATTTCCGGTCCGGCAAGGCGACGCTGAACG
ACTACAATTTCGAGCAGCCGGCCAACGATCTGACCGCGAGCACCACCACCGTGCTCGACAATTCCGCCTT
CAAGAGCTGGGAACTCTACGACTATCCCGGCGACTACGACACCAAGGACAAGGGCACCCCCCTCTCGCGC
CTGCGCATGGAGGCGGAAGAGGTGGACTATGCCGTCTCGCCGGGGGCCTCCACCTATGCCGGCTTCCTGC
CGGGCGCGAAATTCACCATGTCGAAGCATGAGGTGGTCAGCGAGCAGGGCCGCAGCTATGCGCTGCGCAC
GGTCGAGCACAGCGCGCAGGACCTCTCCCATCTCGGCAACCAGAGCGGCAGCGTCTTCTATCGCAACCGC
TTCACCGCCCTGCCCGCCGCGACCGCCTTCCGGCCACCGCGCATCACCCGCCGCCCCCTCATCCCCGGCC
CGCAGACCGCTCTCGTGGTCGGGCCTTCGGGCGAGGAGATCTATTGCGACAAGTACGGCCGCATCCGTCT
GCAATTCTACTGGGACCGTCTCGGCAAGAAGGACGAGAACAGCTCCTGCTGGGTGCGTGTCGCCCAGTCC
CTCGCCGGCTCGAGCTGGGGCACGCAGTTCACCCCCCGCATCGGCATGGAAGTGGTGGTCATCTTCCTGG
AGGGCGATCCCGACCGGCCGCTGGTGGTGAGCGCCGTCTACAACGGCCAGAACATGCCGCCCTATACCCT
GCCCGACAACAAGACCCAGAGCGGCATCAAGACCCGCTCCTCCCCGCAGGGCAGCGCCAGCACGTTCAAC
GAGCTGCGCTTCGAGGACAAGAAGGACAGCGAACTCGTCTACATGCACGCGCAGAAGGACTTCACGCGCG
AGGTCACCAATGACGACACGCTGACCGTCTCCCACGACCAGACCATCACCATCAAGAACAACCGCACCGA
GACGGTCCAGGAAGGCAACGAGAGCGTCACCATCTCCAAGGGCAACCGAACGCTCACGGTGTCCGAGGGC
AACGACAGCCTGACCGTGACCAAGGGCAACCGGAGCGCCACCATCTCCGAGGGCAATGACACGCTGACGC
TTGCGAAGGGAAACGTCACGACGACGCTGAACGGAGGCAATCACACGCTGAAGCTGGATTCCGGCAATGC
GACGATGCAGTGCGACGGCGGCAGCATCACCCTGCAGGCGGCACAGACGATCACGCTCAAGGTCGGCGGC
AATTCCATCACCATCAGCCAGAGCGGCATCTCGCTGAGTGGCACGCAGATAACCATTTCCGGCAGTGCCA
AGGTTCAGGTGAGCGGCTCCATGGTAAACGTCAGCGGCGATGGAACCGTCCAGGTGAAGGGCGGTCTTGT
CACCATCAACTGA