SecReT6
Protein ID: 158424218
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2594
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2923153..2924328 [+]
Productforkhead domain-containing protein
NoteFha
UniProt IDA8IB13
KEGG IDazc:AZC_2594
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-15, Aligned region: 30..98
Protein Sequence: 391 a.a.     [Download]
>gi|158424218|ref|YP_001525510.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MSAVLHLKLMVPGAVPPDQRARSLSDGTLRIGRDADNDWVLEDQSRLISRHHCTITAQAGLFTIIDTSGN
GVFINNAERALGRGNSAILSEGDLLHIGDLTLEVSVVARTDEADAFRAILPPLGMPADLGIGAPETPQPP
PVPVYPPAVSSAPLLAPARRTVGFSPEVPPPPVPDFNTPLNTGWAPAHTPFGDLPQPEIKPHGTPPDHLP
VEEEALPVIRMAPPQIPDDWYLDGTTSEAAAPPPARQPVVPPMAPPASPPALPSAPPPFPDLSAPAARPA
PTPTADERLTLSLIEALSVIENAALPPGQTRMLAGPPEGVLERLLREDPEWVGLSLVSLSAGIADRLGPT
QPPAAPAVPPGTRSAIIPDFPDLDLPERVPNPFRAPGDDQP
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2923153-2924328 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGAGCGCGGTGCTGCATCTCAAGCTGATGGTGCCCGGCGCCGTGCCGCCGGACCAGCGGGCCCGCAGCC
TGTCGGACGGAACGCTCCGCATCGGGCGCGACGCGGACAATGACTGGGTGCTGGAGGACCAGTCGCGCCT
GATCTCCCGCCATCACTGCACCATCACCGCACAGGCGGGCCTGTTCACCATCATCGACACGTCGGGGAAC
GGCGTCTTCATCAACAATGCCGAGCGTGCCCTCGGGCGCGGCAATTCGGCGATCCTGAGCGAAGGCGACC
TGCTGCACATCGGCGACCTGACGCTGGAAGTCTCGGTGGTAGCGCGCACGGACGAGGCGGATGCCTTCCG
CGCCATCCTGCCGCCCCTCGGCATGCCGGCGGATCTCGGCATCGGCGCGCCCGAGACGCCGCAGCCGCCG
CCTGTCCCGGTCTATCCGCCGGCCGTGTCCTCGGCGCCGCTTCTGGCACCGGCCCGCCGGACGGTCGGCT
TCTCGCCCGAAGTGCCGCCGCCCCCCGTGCCGGACTTCAACACACCGCTCAACACCGGCTGGGCTCCAGC
CCACACGCCGTTCGGCGACCTGCCTCAGCCGGAGATCAAGCCCCACGGCACGCCGCCGGACCACCTGCCG
GTGGAGGAAGAAGCCTTGCCGGTCATCCGCATGGCGCCGCCCCAGATCCCCGACGACTGGTATCTGGACG
GAACGACGAGCGAGGCGGCCGCCCCGCCACCCGCCCGGCAGCCGGTGGTGCCGCCCATGGCGCCGCCGGC
GTCGCCTCCTGCCCTTCCCTCCGCCCCGCCGCCGTTCCCGGATCTCTCGGCACCCGCCGCCCGACCGGCG
CCGACACCGACGGCCGACGAGCGCCTCACGCTCTCCCTCATCGAGGCCCTGAGCGTGATTGAGAATGCCG
CCTTGCCGCCGGGCCAAACCCGCATGCTGGCCGGACCGCCGGAGGGGGTGCTGGAGCGCCTGTTGCGGGA
AGATCCCGAATGGGTCGGCCTGTCCCTCGTCAGCCTGTCCGCGGGCATCGCAGACAGGCTGGGCCCTACC
CAGCCGCCCGCTGCCCCTGCCGTGCCCCCGGGCACGCGCAGCGCGATCATTCCCGATTTCCCCGACCTTG
ACCTGCCCGAGCGCGTCCCGAACCCGTTCCGCGCTCCCGGAGACGATCAGCCATGA