SecReT6
Protein ID: 158424219
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2595
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2924325..2925659 [+]
Producthypothetical protein
NoteTssK
UniProt IDA8IB15
KEGG IDazc:AZC_2595
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.20E-157, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|158424219|ref|YP_001525511.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MSSNSKVVWSEGMFLRAQHFQQQDRYTERLVRQRVDGITPYAWGFRSLEIDRGLLGLGKFALASADGVFP
DGTPFRIPDDDAHPPAIDLPVGLSESTVYLCLPVTLRGAPEFDVSEQFNSTARFASEESDVVDAISGAQG
VSRIRTARLRLSLMLEHEDRSGYQCLGVVRIQEVVADRKINLDTGYIPPSLSCAASPVLGGFLNEVSAML
HHRGSALAPRLTGSTAHGVAEVADFLMLQLTNRMEPLLGHLAGLPHLHPERLYATFLELAGELSTFTAPD
KRPRELPAYRHDDLALTFLALMSELRAQLSAVLEQAAVQIPLQDRKYGIRVGVIADRTLLTGAVFVLIFK
ASLPDEAVRRTLPALIKIGPVEQIRELVNVQLPGIRIQPLAVAPRQIPYRSGAVYFQLESDNTMWSQMAS
SGGIAVHLAGDFPDAAMELWAIRR
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2924325-2925659 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGAGTTCCAACAGCAAAGTCGTCTGGTCGGAGGGCATGTTCCTCAGGGCACAGCACTTCCAGCAGCAGG
ACCGCTACACGGAACGGCTCGTGCGCCAGCGCGTGGACGGCATCACGCCCTACGCCTGGGGGTTCCGCTC
GCTGGAGATCGACCGCGGCCTGCTCGGCCTCGGCAAGTTCGCCCTCGCCTCGGCCGACGGCGTATTTCCC
GACGGCACGCCCTTCCGCATTCCCGATGACGATGCCCATCCTCCGGCCATCGACCTGCCAGTGGGCCTGT
CCGAAAGCACCGTCTATCTGTGCCTGCCCGTCACGCTGCGCGGCGCGCCCGAGTTCGACGTCTCCGAACA
GTTCAATTCGACCGCCCGCTTCGCCTCGGAGGAGAGCGACGTGGTGGACGCCATCAGCGGCGCGCAGGGC
GTCTCGCGCATCCGCACGGCCCGGCTGCGGCTGTCGCTCATGCTCGAGCATGAGGATCGCTCCGGCTACC
AGTGCCTCGGCGTCGTGCGGATCCAGGAGGTGGTGGCCGACCGGAAGATCAATCTCGATACCGGCTACAT
CCCCCCGAGCCTGAGCTGCGCCGCCTCGCCCGTCCTCGGCGGGTTCCTCAACGAGGTCTCCGCCATGCTG
CATCATCGCGGTTCGGCGCTCGCCCCAAGGCTCACCGGCTCGACGGCGCACGGCGTCGCGGAGGTGGCGG
ACTTCCTGATGCTCCAGCTCACCAACCGCATGGAGCCGCTGCTCGGGCATCTCGCCGGGCTGCCCCATCT
CCATCCCGAGCGGCTCTACGCCACCTTCCTGGAACTGGCCGGCGAATTGTCCACCTTCACCGCGCCGGAC
AAGCGTCCGCGCGAGCTCCCCGCCTACCGCCACGACGATCTAGCCCTGACCTTCCTCGCCCTGATGTCGG
AACTGCGCGCCCAGCTCAGCGCCGTGCTGGAGCAGGCGGCGGTGCAGATCCCGCTGCAGGACCGCAAGTA
TGGCATCCGCGTCGGCGTGATCGCCGACCGCACGCTCCTCACGGGCGCGGTGTTCGTGCTCATCTTCAAG
GCGAGCCTGCCGGACGAGGCCGTGCGCCGGACGCTTCCCGCACTCATCAAGATCGGTCCGGTGGAGCAAA
TTCGAGAACTGGTTAACGTGCAGCTGCCGGGCATCCGCATTCAGCCCCTCGCGGTGGCGCCACGCCAGAT
TCCGTACCGCTCGGGGGCAGTCTATTTCCAGTTGGAGTCGGACAATACCATGTGGTCGCAAATGGCCTCT
TCGGGCGGCATTGCCGTACATCTGGCGGGTGATTTCCCTGATGCGGCGATGGAACTCTGGGCCATTCGGC
GGTAG