SecReT6
Protein ID: 158424220
SecReT6 ID235
T6SS typei5
Gene symbolompA
Locus tagAZC_2596
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2925898..2927382 [+]
ProductOmpA family protein
NoteTssL
UniProt IDA8IB18
KEGG IDazc:AZC_2596
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.90E-50, Aligned region: 100..301
OmpA [PF00691], Evalue: 2.70E-14, Aligned region: 387..485
Protein Sequence: 494 a.a.     [Download]
>gi|158424220|ref|YP_001525512.1| ompA gene product [Azorhizobium caulinodans ORS 571]
MARDTDPQSDAETTIVAPAARWRAPANEQPVSQVAPGRAAPVGTFPFPRPPGSDGRLKPVEREAPRKGPA
APTVPPLPTARTDDRALKAALEVYQDNPGLALAVPIFELLVRAQLQPTGDADEFHDHLLDELQTFETQAI
SRGLSQQHTRLILYAIAATADDCILNTRWGNESDWAAKTLVSALFQETWGGERFFGLLNQMMAAPHSVVR
EIEFYYFCLQFGFEGKYRLAANGSGELTRLKDDVFQFLRSVRGGVKPELSPNWRGLSAENQGPGDLLPLV
FYGAGIALFLLLLFIGYSLVLRREANLAVQQVQNLMAEPVVIRTPPVATAAAAPAPAPTPAAPPAPKPPA
ETPLQVISGFLEPEQQAKLITVFGRGNSVVIQTQQELFASASTTLRPPYPEVIAKVAAALAKFKGPVNVL
GYTDNVPIRTATFPDNLALSTARARAVGQALAAGLGGNARITTVGKGDADPVASNDTPDGRQKNRRVEIV
LTPQ
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2925898-2927382 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGGCCAGAGACACTGATCCACAATCGGACGCGGAGACGACCATCGTCGCTCCCGCCGCGCGGTGGCGTG
CTCCGGCCAATGAGCAACCTGTGTCGCAGGTCGCTCCGGGCCGTGCGGCGCCTGTCGGCACCTTCCCCTT
TCCCCGGCCGCCAGGCAGCGACGGCCGCCTGAAGCCTGTCGAGCGGGAGGCCCCGCGCAAGGGACCGGCC
GCGCCGACCGTGCCGCCCCTGCCGACCGCGCGCACCGATGACCGTGCCCTCAAGGCGGCGCTTGAGGTCT
ATCAGGACAATCCGGGCCTTGCGCTCGCCGTTCCGATCTTCGAGTTGCTGGTGCGGGCGCAGTTGCAGCC
CACCGGCGACGCGGACGAGTTCCACGACCACCTGCTCGATGAGCTCCAGACCTTCGAGACCCAGGCCATC
TCGCGCGGCCTGTCGCAACAGCACACGCGCCTGATCCTCTACGCGATCGCGGCCACGGCCGACGACTGCA
TCCTGAACACGCGCTGGGGCAACGAGAGCGACTGGGCGGCGAAGACGCTGGTCTCGGCGCTCTTCCAGGA
AACCTGGGGCGGCGAGCGGTTCTTCGGCCTGCTCAACCAGATGATGGCGGCGCCGCACTCGGTCGTGCGC
GAGATCGAATTCTACTATTTTTGCCTTCAGTTCGGCTTCGAGGGCAAATACCGCCTCGCCGCCAACGGCA
GCGGGGAACTGACGCGGCTCAAGGACGACGTCTTCCAGTTCCTGCGCAGCGTGCGCGGCGGCGTGAAGCC
GGAACTCTCGCCCAACTGGCGCGGCCTTTCCGCCGAGAACCAGGGCCCCGGCGATCTGCTGCCGCTGGTG
TTCTACGGCGCCGGCATCGCGCTCTTCCTGCTGCTGCTGTTCATCGGCTATTCGCTGGTGCTGCGGCGCG
AGGCGAACCTCGCCGTCCAGCAGGTGCAGAACCTCATGGCCGAGCCGGTGGTCATCCGCACGCCGCCGGT
GGCGACGGCGGCCGCCGCCCCGGCACCTGCTCCCACGCCCGCCGCTCCGCCCGCGCCCAAGCCGCCGGCC
GAGACGCCCCTTCAGGTCATCTCCGGCTTCCTGGAGCCCGAGCAGCAGGCCAAGCTCATCACCGTGTTCG
GCCGTGGCAATTCAGTGGTCATCCAAACCCAGCAGGAGCTGTTCGCCTCCGCCAGCACGACCCTGCGCCC
ACCCTATCCTGAGGTGATCGCCAAGGTCGCGGCGGCGCTCGCCAAGTTCAAGGGGCCGGTCAACGTGCTG
GGCTACACCGACAACGTGCCCATCCGCACCGCCACCTTCCCGGACAATCTCGCCCTCTCGACGGCCCGCG
CCCGCGCGGTGGGACAGGCCCTCGCGGCGGGCCTCGGCGGCAACGCCCGCATCACGACGGTCGGCAAAGG
CGACGCCGACCCCGTCGCGTCCAACGACACGCCGGACGGGCGGCAGAAGAACCGCCGCGTCGAAATCGTT
CTCACGCCGCAATAG