SecReT6
Protein ID: 158424222
SecReT6 ID235
T6SS typei5
Gene symbolimpA
Locus tagAZC_2598
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2931067..2932233 [+]
ProductImpA-related N-terminal protein
NoteTssA
UniProt IDA8IB23
KEGG IDazc:AZC_2598
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.50E-17, Aligned region: 72..133
ImpA-rel_N [PF06812], Evalue: 4.50E-17, Aligned region: 224..241
Protein Sequence: 388 a.a.     [Download]
>gi|158424222|ref|YP_001525514.1| impA gene product [Azorhizobium caulinodans ORS 571]
MKDSENSMTVEPTFDVSEGLAPIGDPPGCGTDPRADMSGNSPFLQMKDARADARRKERALDVDPDAPGAE
DDWGSAGELGMQILSGVGKDLEVAAWVIEALVRLDGYRGLYTGCLLAEGLVRTFWDGIFPLPDEDGNDGR
LSPFVALNGEDGEGLLIQPLRKIPLTAGSEHFSYWQYEQAREIAQIGDADRREARIAAGGLSMDAFDEAV
GSTPPSFFADLIAQIEAALAALNALSDAFSERVGVDAPPAGAIRNLLNTVLDDVRIFAASKLEQASASQL
SEQAGSDEAAGGGETAGDGEAETGGAPGAPRGPVANREQALRLILEAARFFRTNEPHSPISYTLEEIVRR
ARLPMGALIEELIVDPEARRYFYLAAGLRPPANPEPQE
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2931067-2932233 Azorhizobium caulinodans ORS 571 chromosome, complete genome
GTGAAGGACAGCGAGAACAGCATGACGGTCGAACCGACTTTTGACGTTTCTGAAGGTCTTGCGCCGATCG
GCGACCCGCCGGGTTGCGGAACCGATCCGCGCGCCGACATGTCCGGCAACTCGCCCTTCCTGCAGATGAA
GGACGCGCGCGCCGACGCGCGCCGGAAGGAACGGGCGCTCGACGTGGACCCCGACGCACCGGGCGCGGAG
GACGACTGGGGCTCGGCCGGCGAACTCGGCATGCAGATCCTGTCCGGCGTCGGCAAGGATCTGGAGGTGG
CCGCCTGGGTCATCGAGGCGCTCGTGCGGCTCGACGGCTACCGTGGCCTCTATACGGGCTGCCTGCTGGC
CGAAGGCCTCGTCCGCACCTTCTGGGACGGCATCTTTCCGCTGCCCGATGAGGACGGCAATGACGGGCGC
CTCTCGCCCTTCGTGGCGCTCAACGGCGAGGATGGCGAGGGCCTTCTCATCCAGCCGCTGCGCAAGATCC
CGCTGACGGCCGGCAGCGAGCATTTCTCCTACTGGCAGTACGAGCAGGCCCGCGAGATCGCGCAAATCGG
CGATGCCGACCGCCGGGAGGCGCGTATCGCCGCCGGTGGGCTGAGCATGGACGCCTTCGACGAGGCCGTC
GGCTCGACACCGCCGTCCTTCTTCGCGGATCTCATCGCCCAGATCGAGGCAGCGCTGGCCGCGCTGAACG
CTCTGTCAGATGCCTTTTCCGAGCGTGTGGGCGTGGATGCCCCGCCGGCCGGGGCCATCCGCAACCTGCT
CAACACTGTCCTCGACGACGTGCGCATCTTCGCGGCGTCCAAGCTCGAGCAGGCGAGCGCCAGCCAGCTC
TCCGAGCAGGCCGGATCTGACGAGGCGGCCGGCGGCGGCGAGACCGCGGGCGACGGGGAAGCCGAAACGG
GCGGAGCGCCCGGCGCCCCCCGCGGGCCCGTGGCCAATCGCGAGCAGGCCCTGCGGCTGATCCTCGAGGC
GGCCCGCTTCTTCCGGACCAACGAGCCGCATTCGCCGATCTCCTACACGCTGGAGGAGATCGTCCGGCGG
GCGCGCCTGCCCATGGGCGCGCTCATCGAGGAACTCATCGTCGATCCGGAAGCCCGTCGTTACTTCTACC
TTGCCGCAGGCTTGAGGCCGCCGGCAAATCCGGAACCGCAAGAATAA