SecReT6
Protein ID: 158424223
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2599
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2932298..2932810 [+]
Producthypothetical protein
NoteTssB
UniProt IDA8IB24
KEGG IDazc:AZC_2599
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.20E-61, Aligned region: 8..162
Protein Sequence: 170 a.a.     [Download]
>gi|158424223|ref|YP_001525515.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MPSIHEKLNRVRKPRVHITYDVETEGAVVEKELPFVVGVMGDFSGDPSEPLKPLNERKFIQIDRDNFDQV
LARMTPGLKMKVDNTLADDGSQLSVDLSFKSLEDFSPAAVVDRVEPLRKLMDVRSQLRDLLSKADRSENL
ESLLEKILSNEEQLKALSEQLGVGAEKKEG
 
Nucleotide Sequence: 513 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2932298-2932810 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGCCCAGCATCCATGAAAAACTCAATCGCGTGCGCAAGCCGCGCGTCCACATCACCTATGATGTCGAGA
CCGAAGGCGCGGTCGTCGAGAAGGAGCTGCCCTTCGTCGTCGGCGTCATGGGCGATTTCTCCGGCGATCC
GAGCGAGCCCCTGAAACCGCTCAACGAGCGCAAGTTCATCCAGATCGACCGGGACAATTTCGATCAGGTG
CTGGCGCGCATGACGCCCGGGCTGAAGATGAAGGTGGACAACACCCTCGCGGACGACGGCAGCCAGCTCA
GCGTCGATCTGAGCTTTAAGTCGCTGGAGGATTTCTCCCCGGCCGCCGTGGTCGATCGGGTCGAGCCCCT
GCGCAAGCTGATGGACGTGCGCAGCCAGCTGCGCGACCTGCTCTCCAAGGCCGACCGGTCGGAGAACCTG
GAAAGCCTCCTGGAGAAGATCCTGTCGAACGAGGAACAGCTGAAGGCCCTGAGCGAACAGCTCGGCGTCG
GCGCCGAAAAGAAGGAGGGCTGA