SecReT6
Protein ID: 158424224
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2600
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2932815..2934299 [+]
Producthypothetical protein
NoteTssC
UniProt IDA8IB27
KEGG IDazc:AZC_2600
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-193, Aligned region: 62..491
Protein Sequence: 494 a.a.     [Download]
>gi|158424224|ref|YP_001525516.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MAETQEQAAAGATETQEASFLDQAIAATKQTDPDRTAELLRTLTQEALAGTVTYSKNLTQTINNAIVAID
AKISTQLNAIMHHPDFQKLEGTWRGLNYLVMNSETGSSLKIRVINCTKRELYKSLTKASEFDQSTIFKKI
YESEFGSPGGEPYGALIGDYEFGNHPEDTELLSLMSNVAAAAFAPFVTAASPKMFGFDDFTELSKPRDLE
KIFETVEYAKWRSFRESDDSRFVTLTMPRTLARLPYGANTKVVEDFDYEESPIVDGTPRGMKHEDYCWMN
SSYVLGARLTDAFAQHGWCTAIRGAEGGGKVENLPSHVFVSDDGDSDQQCPTEIGITDRREAELSKLGFL
PLCHYKGTDYAVFFGAQTTQKPKKYDRPEATANAAISARLPYIMATSRFAHYLKIMGRDKVGSFMEASDC
EAWLNRWIINYVNGNPDAGQDMKAKYPLAEAKVEVREIPGKPGSYNAVAWLRPWLQMEELTTSLRMVARI
PASS
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2932815-2934299 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGGCCGAGACTCAGGAACAAGCCGCCGCCGGCGCAACGGAAACGCAGGAAGCCTCCTTCCTCGACCAGG
CCATCGCGGCCACCAAGCAGACCGACCCGGACCGCACGGCTGAGCTTCTGCGCACGCTGACGCAGGAAGC
GCTCGCCGGAACCGTCACTTATTCGAAGAACCTCACGCAGACGATCAACAACGCCATCGTTGCGATCGAC
GCGAAGATCTCGACGCAACTCAATGCAATCATGCACCATCCCGACTTCCAGAAGCTGGAAGGCACGTGGC
GGGGCCTGAACTATCTGGTGATGAATTCGGAGACCGGCAGCAGCCTGAAGATCCGGGTCATCAACTGCAC
CAAGCGCGAGCTCTACAAGTCGCTCACCAAGGCCTCTGAGTTCGACCAGTCCACCATCTTCAAGAAGATC
TACGAGAGCGAGTTCGGCAGCCCCGGCGGCGAGCCCTATGGCGCGCTCATCGGCGACTACGAGTTCGGCA
ACCATCCCGAGGACACCGAGCTGCTCTCGCTCATGTCCAACGTGGCGGCGGCGGCGTTCGCCCCCTTCGT
CACGGCGGCGAGCCCGAAGATGTTCGGCTTCGACGACTTCACCGAGCTGTCCAAGCCACGCGATCTCGAG
AAGATCTTCGAGACGGTGGAATACGCCAAGTGGCGCTCGTTCCGGGAATCCGATGATTCCCGTTTCGTCA
CGCTCACCATGCCGCGCACGCTGGCCCGCCTCCCCTATGGCGCCAATACCAAGGTGGTGGAAGACTTCGA
CTATGAGGAAAGCCCCATCGTCGACGGCACCCCGCGCGGCATGAAGCACGAAGACTATTGCTGGATGAAT
TCGTCCTACGTACTCGGCGCCCGTCTCACGGACGCCTTCGCCCAGCACGGCTGGTGCACCGCCATCCGCG
GCGCCGAGGGCGGCGGCAAGGTGGAGAACCTGCCGAGCCACGTCTTCGTCTCCGACGACGGCGACAGCGA
CCAGCAGTGCCCGACCGAGATCGGCATCACCGACCGGCGCGAGGCGGAGCTCTCCAAGCTCGGCTTCCTG
CCGCTGTGCCACTACAAGGGCACGGACTATGCGGTGTTCTTCGGCGCCCAGACGACGCAGAAGCCCAAGA
AGTACGACCGCCCCGAGGCGACGGCGAACGCCGCCATCTCGGCGCGCCTGCCCTACATCATGGCCACCTC
GCGCTTCGCGCACTACCTGAAGATCATGGGCCGCGACAAGGTCGGCTCCTTCATGGAAGCGAGCGACTGC
GAGGCCTGGCTGAACCGCTGGATCATCAATTACGTCAACGGCAACCCGGATGCCGGCCAGGACATGAAGG
CCAAGTATCCGCTCGCCGAGGCGAAGGTGGAGGTCCGCGAGATCCCCGGCAAGCCGGGCTCGTACAACGC
GGTCGCGTGGCTCCGCCCCTGGCTGCAGATGGAAGAGCTGACCACCTCGCTGCGCATGGTGGCCCGCATT
CCGGCCTCCTCGTAA