SecReT6
Protein ID: 158424226
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2602
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2936068..2936868 [+]
Producthypothetical protein
NoteTagJ
UniProt IDA8IB32
KEGG IDazc:AZC_2602
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.60E-35, Aligned region: 142..263
TPR_19 [PF14559], Evalue: 2.50E-07, Aligned region: 8..72
TPR_19 [PF14559], Evalue: 2.50E-07, Aligned region: 103..130
TPR_16 [PF13432], Evalue: 3.40E-06, Aligned region: 7..65
TPR_16 [PF13432], Evalue: 3.40E-06, Aligned region: 94..132
TPR_11 [PF13414], Evalue: 0.00019, Aligned region: 7..63
TPR_11 [PF13414], Evalue: 0.00019, Aligned region: 103..133
TPR_14 [PF13428], Evalue: 0.0002, Aligned region: 8..41
TPR_14 [PF13428], Evalue: 0.0002, Aligned region: 33..66
TPR_14 [PF13428], Evalue: 0.0002, Aligned region: 108..132
TPR_2 [PF07719], Evalue: 0.00033, Aligned region: 8..23
TPR_2 [PF07719], Evalue: 0.00033, Aligned region: 37..64
TPR_2 [PF07719], Evalue: 0.00033, Aligned region: 103..132
TPR_20 [PF14561], Evalue: 0.0044, Aligned region: 16..68
TPR_12 [PF13424], Evalue: 0.0099, Aligned region: 27..56
TPR_12 [PF13424], Evalue: 0.0099, Aligned region: 35..59
TPR_12 [PF13424], Evalue: 0.0099, Aligned region: 103..138
Protein Sequence: 266 a.a.     [Download]
>gi|158424226|ref|YP_001525518.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MQDTPLHLFQEGKLTDAIAAMNQQVKEKPLDIALRSQLAELLCVAGDLDRAERQFEAIAQQDPKTALQVG
SLRQLLRSSQARRQVFLEGRAPDVLEEPPAHVALRLEALMHLREGRAAEAGASLAKAEELRPPLAGRHND
IGFVDFRDLDDLLGGILEVMTTTGKYFWVPMERVETLEFEAPRRMLDSAWRMAQISVRGGPQGEVAIPST
YPATGEAPSDAVRLGRETDWTEVAPDCVRGSGLRTFLVGEESLTILQLGRLEFDVQ
 
Nucleotide Sequence: 801 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2936068-2936868 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGCAGGACACGCCACTTCATCTGTTCCAGGAAGGCAAGCTGACGGACGCCATCGCCGCCATGAACCAGC
AGGTGAAGGAAAAGCCGCTGGACATCGCGCTGCGCAGCCAGTTGGCGGAGCTTCTGTGTGTGGCGGGCGA
CCTCGACCGGGCCGAGCGCCAGTTCGAGGCCATCGCCCAGCAGGACCCGAAGACCGCCCTGCAGGTGGGG
AGCCTGCGCCAACTCCTGCGGTCGAGCCAGGCCCGCCGCCAGGTGTTCCTGGAAGGCCGGGCGCCGGACG
TCCTCGAGGAGCCGCCGGCCCATGTGGCGCTGCGCCTCGAGGCCCTGATGCACCTGCGGGAAGGGCGCGC
GGCGGAGGCCGGGGCGAGCCTTGCCAAGGCGGAAGAGCTGCGTCCCCCGCTCGCCGGCCGCCACAACGAC
ATCGGGTTCGTGGATTTTCGCGATCTCGACGATCTTCTCGGCGGCATCCTCGAAGTGATGACCACCACGG
GCAAATATTTCTGGGTGCCCATGGAAAGGGTGGAGACACTGGAATTCGAGGCGCCACGCCGGATGCTGGA
CAGTGCCTGGCGCATGGCGCAGATCAGCGTGCGCGGCGGGCCTCAGGGCGAGGTGGCGATCCCCTCCACC
TATCCCGCCACGGGAGAGGCTCCGTCCGATGCGGTCCGTCTCGGCCGTGAGACCGACTGGACCGAGGTGG
CGCCCGACTGCGTCCGCGGCTCGGGCCTGCGCACCTTCCTCGTGGGCGAGGAGAGCCTTACCATTCTCCA
GTTGGGACGACTGGAGTTCGACGTCCAATGA