SecReT6
Protein ID: 158424227
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2603
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2936865..2937317 [+]
Producthypothetical protein
NoteTssE
UniProt IDA8IB33
KEGG IDazc:AZC_2603
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-16, Aligned region: 25..126
Protein Sequence: 150 a.a.     [Download]
>gi|158424227|ref|YP_001525519.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MSPPASVTLSVLDRLRGGEGPRVARIRDGIRQDLQDLLNTPNRVIGWSQALDQLETSILNYGIMDLCTAN
LSTEQQRAAVVEEIGRMIRLYEPRLSDMRIHALANADPSDRSLRLRIEARIYVENEVEPIIFNTVVDPVL
NAISLSSATP
 
Nucleotide Sequence: 453 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2936865-2937317 Azorhizobium caulinodans ORS 571 chromosome, complete genome
ATGAGCCCTCCGGCCAGTGTGACGCTGTCTGTTCTGGATCGCCTGCGCGGGGGCGAGGGTCCCCGCGTCG
CGCGCATCCGCGACGGCATCCGGCAGGACCTGCAGGATCTGCTGAACACGCCGAACCGTGTGATCGGCTG
GTCGCAGGCGCTGGATCAGCTCGAGACGTCCATCCTGAACTACGGGATCATGGATCTGTGCACCGCCAAT
CTCTCCACGGAGCAGCAGCGGGCCGCCGTGGTGGAGGAGATCGGCCGCATGATCCGGCTCTACGAGCCGC
GCCTCTCGGACATGCGCATCCATGCGCTGGCCAATGCCGATCCCTCCGATCGCTCGCTCCGCCTGCGGAT
CGAGGCCCGCATCTATGTGGAGAACGAGGTTGAGCCCATCATCTTCAACACGGTCGTCGATCCGGTGCTG
AACGCCATTTCGCTGTCGAGCGCCACACCGTGA