SecReT6
Protein ID: 158424228
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2604
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2937314..2939137 [+]
Producthypothetical protein
NoteTssF
UniProt IDA8IB36
KEGG IDazc:AZC_2604
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.50E-190, Aligned region: 5..607
Protein Sequence: 607 a.a.     [Download]
>gi|158424228|ref|YP_001525520.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MSDHLLPYYNRELLYLRRMAQEFAARHPKIAGNLRMSGDGIDDPHVARLAEGVAFLNARIAHKLDDEFPE
LVNTMLDILYPNYLAPIPSMATVQFKPKPEVTTPQTIPVDTELDSEPVDSETCRFRTRYPVTLWPVTVAD
ASLKGRPIVAPSGPRTAGAFSCLRLTLRCSAPDTTFSDLQPDHLRFFLRGQPSHVYALHEMLFNNAVAVA
LADSASDPTPVLLPPTAIRPVGFGPDEVILPYPAQSQPAYRTLTEFFVFPDKFLYFDVDLSTKVLGNAGA
ELSVFIYFNKSDLALERSISKEFFALGCTPIVNLFRQRSEPVIVGHNRLEYRVIADARRPEALEIHSLNS
VVATDAEGRRKTISPFYARRPKGDETHAGYWAMARRKSEGRLSGTEVFLSFSEIDPAFASTDIVVSAETL
CLNRDLPARLPYGGGHPKLTPVQAAAAIGEVNCISPLTHTIRVPEGESRNWRLISHLLLNHLSLVGAGGL
EALQEILMLYDFRGSPETRLMIEGITDLSARRGTARAPRRPGDAAWGDAICQGIDLAVEFNPANFSGSSL
FLFAMVLDQFFGLHASINSFTRLTATVKGQPGILRTWPARAGFRPLL
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2937314-2939137 Azorhizobium caulinodans ORS 571 chromosome, complete genome
GTGAGCGATCATCTCCTTCCGTATTACAATCGCGAGCTTCTCTATCTGCGCCGCATGGCGCAGGAATTTG
CCGCCCGTCACCCCAAGATCGCCGGCAACCTGCGCATGAGCGGGGACGGCATCGACGATCCCCACGTCGC
CCGTCTCGCCGAAGGCGTCGCCTTCCTCAATGCCCGCATCGCCCACAAGCTGGACGACGAGTTCCCCGAA
CTCGTCAACACGATGCTGGACATTCTCTATCCGAACTATCTCGCGCCCATTCCTTCCATGGCGACGGTGC
AGTTCAAGCCCAAGCCCGAGGTGACCACCCCGCAGACCATCCCCGTGGACACGGAACTGGATTCCGAGCC
CGTGGATTCGGAAACCTGCCGCTTCCGCACCCGCTATCCGGTCACCCTCTGGCCGGTCACGGTCGCCGAT
GCCAGCCTCAAGGGGCGTCCCATCGTGGCCCCCAGCGGCCCACGCACGGCCGGCGCCTTCTCCTGCCTGC
GGCTCACCCTGCGCTGCTCGGCGCCCGATACGACCTTCTCGGACCTGCAGCCGGATCACCTGCGCTTCTT
CCTGCGCGGACAGCCCTCGCACGTCTATGCGCTGCACGAGATGCTGTTCAACAACGCCGTCGCCGTGGCT
CTGGCGGATTCGGCGAGCGATCCCACTCCCGTGCTGCTGCCGCCCACCGCCATCCGCCCGGTGGGCTTCG
GGCCCGACGAGGTGATCCTGCCCTACCCAGCGCAGTCGCAGCCCGCATACCGGACCCTCACCGAATTCTT
CGTCTTCCCGGACAAGTTCCTGTATTTCGACGTCGATCTCAGCACCAAGGTGCTGGGGAACGCCGGGGCG
GAGCTTTCCGTCTTCATCTATTTCAACAAGAGCGATCTGGCGCTGGAGCGCAGCATTTCCAAGGAGTTCT
TCGCCCTTGGCTGCACCCCCATCGTCAATCTGTTCCGCCAGCGCAGCGAGCCGGTGATCGTCGGGCACAA
TCGCCTCGAATACCGTGTCATCGCCGATGCCCGCCGCCCGGAGGCGCTGGAAATCCACTCCCTGAACTCC
GTCGTCGCCACCGACGCAGAGGGGCGCCGCAAGACCATCTCGCCCTTCTACGCGCGCCGTCCCAAGGGCG
ACGAGACACACGCCGGCTACTGGGCCATGGCGCGTCGCAAGTCGGAGGGGCGGCTGTCGGGCACCGAGGT
CTTCCTCTCCTTCTCCGAAATCGATCCGGCCTTCGCCAGCACGGACATCGTGGTCTCGGCCGAGACGCTC
TGCCTCAACCGCGACCTGCCGGCCCGCCTGCCCTATGGCGGCGGGCATCCCAAGCTGACCCCCGTCCAGG
CGGCCGCGGCCATCGGCGAGGTCAACTGCATCTCGCCCCTCACGCACACCATCCGCGTGCCGGAGGGCGA
GTCCCGCAACTGGCGCCTCATCTCGCACCTGCTGCTGAACCACCTCTCTCTCGTCGGCGCGGGCGGGCTT
GAGGCCCTGCAGGAAATCCTGATGCTCTACGACTTCCGTGGCTCGCCGGAGACACGGCTCATGATCGAAG
GCATCACCGACCTGTCCGCGCGGCGCGGCACCGCCCGCGCGCCCCGCCGGCCGGGCGATGCCGCCTGGGG
TGATGCGATCTGCCAGGGCATCGACCTCGCCGTCGAATTCAATCCGGCCAATTTCAGCGGCAGCAGCCTG
TTCCTGTTCGCCATGGTGCTCGACCAGTTCTTCGGGCTGCATGCATCGATCAATTCATTCACCCGCCTCA
CGGCCACCGTGAAGGGACAACCGGGAATTCTCCGCACATGGCCGGCGCGCGCAGGCTTCCGTCCTCTCCT
GTGA