SecReT6
Protein ID: 158424229
SecReT6 ID235
T6SS typei5
Gene symbol-
Locus tagAZC_2605
StrainAzorhizobium caulinodans ORS 571
Repliconchromosome [GenBank: NC_009937] [Browse all T6SS(s) in this replicon]
Location [Strand]2939134..2940198 [+]
Producthypothetical protein
NoteTssG
UniProt IDA8IB38
KEGG IDazc:AZC_2605
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-75, Aligned region: 7..334
Protein Sequence: 354 a.a.     [Download]
>gi|158424229|ref|YP_001525521.1| unnamed protein product [Azorhizobium caulinodans ORS 571]
MIDALLRAPHSFDLAQAVRVVDALFNLPHADSEGSEETATSDAWEAPGLWDGGSIRFISDTSLRYPVAAI
TRASQREPGDPLELTVSTIGLIGPLGVLPYAYTAHANEGMRERNEGVRAFLDMFNHRAVSLFCRASAKYR
IALAHEGANHDLRDVFTLSLRGLTGLGSPQLENRLAIPDDLVLHNAGLFSGQTRPLAALEALLSRELGQS
VRVEPFTGGWVEVPAAEQTRLGGASALEGQHAHLDSSAMVGARAWVAQHHFRIHVGPTDEAELVSLLPGT
PRAALIRDLVQLFCGLEFSFDLNVMIKAASVPAARLCQGEDDPGGARLGQLAWVLSAPSPIDRNDAIFPL
SALD
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|158421624|ref|NC_009937.1|:2939134-2940198 Azorhizobium caulinodans ORS 571 chromosome, complete genome
GTGATCGACGCGCTGCTGCGCGCGCCCCACAGCTTCGACCTCGCGCAGGCGGTGCGCGTGGTGGATGCGC
TGTTCAATCTGCCCCATGCCGACAGCGAGGGCAGCGAGGAGACCGCGACCAGCGACGCATGGGAAGCGCC
GGGCCTCTGGGATGGGGGCAGCATCCGCTTCATCAGCGACACCAGCCTGCGCTATCCCGTGGCCGCCATC
ACCCGCGCATCCCAGCGGGAGCCGGGCGACCCGCTGGAACTCACCGTCTCCACCATCGGCCTGATCGGGC
CCCTCGGCGTGCTGCCCTATGCCTATACGGCGCACGCCAACGAAGGCATGCGCGAACGCAATGAGGGCGT
GCGCGCCTTCCTCGACATGTTCAACCACCGCGCGGTGTCCCTCTTCTGCCGCGCCAGCGCCAAGTACCGG
ATCGCGCTCGCCCACGAGGGCGCGAACCACGACCTGCGGGACGTGTTCACGCTGAGCCTGCGGGGCCTCA
CCGGGCTCGGCTCGCCGCAGCTTGAGAACCGCCTCGCCATTCCCGACGATCTCGTGCTGCACAATGCCGG
CCTGTTCTCCGGCCAGACCCGACCGCTGGCGGCGCTGGAAGCGCTGCTGAGCCGCGAACTCGGGCAGAGC
GTGCGCGTGGAGCCTTTCACCGGCGGGTGGGTGGAGGTTCCGGCGGCCGAACAGACGCGTCTCGGCGGCG
CCAGCGCCCTCGAGGGGCAGCACGCCCATCTCGATTCCAGCGCCATGGTCGGCGCCCGCGCCTGGGTGGC
CCAGCACCATTTCCGTATCCATGTGGGCCCCACGGACGAAGCCGAACTTGTCTCCCTGCTGCCGGGCACG
CCGCGGGCGGCGCTGATCCGCGATCTCGTCCAGCTCTTCTGCGGCCTCGAGTTCAGCTTCGACCTCAACG
TCATGATCAAGGCCGCGAGCGTTCCGGCAGCGCGGCTGTGCCAGGGCGAGGACGATCCGGGCGGAGCCCG
GCTGGGCCAGCTCGCCTGGGTGCTCAGTGCCCCGAGCCCCATCGACCGCAACGACGCCATCTTCCCCTTG
AGCGCGCTGGACTGA