SecReT6
Protein ID: 158512115
SecReT6 ID791
T6SS typei4b
Gene symbolevpP
Locus tagEvpP
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]3625..4182 [+]
ProductEvpP
NoteEvpP (e)
UniProt IDA8YQR4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 185 a.a.     [Download]
>gi|158512115|ref|ABW69080.1| EvpP [Edwardsiella tarda]
MSILNSELDWSHVGSISTGPGTVVSDAFNISYGLPTKELLPAGTALYKFNGFSSLARPPITDDTPLSPWW
SPVQPFRHDGGLQQRMLVAKLNGVSMREWGRLTSVIKENWSSLDHLLEIVLKVPVYAWFGGFKGMSRIDN
GMPSKRNITLEQKGRGSNLPGGATQFYIPNLTVGHISSHNFSALK
 
Nucleotide Sequence: 558 bp     [Download]
>gi|158512110|gb|AY424360|evpP|:3625-4182
ATGTCGATTTTGAATTCGGAGCTGGACTGGTCCCATGTCGGGAGTATTTCTACAGGCCCAGGCACCGTCG
TCAGTGATGCATTTAACATATCCTATGGGCTGCCGACGAAAGAGCTGCTTCCGGCGGGAACAGCCTTATA
CAAATTCAATGGATTTAGTTCATTGGCAAGGCCCCCGATCACTGACGATACCCCACTGTCTCCCTGGTGG
AGCCCGGTCCAGCCATTCCGCCACGATGGCGGTCTGCAGCAGCGTATGCTGGTCGCTAAGCTAAACGGCG
TATCAATGAGGGAGTGGGGACGACTCACCTCTGTCATCAAAGAAAACTGGAGTTCTCTCGACCATTTACT
TGAGATAGTCCTAAAGGTTCCCGTCTATGCCTGGTTTGGGGGATTTAAGGGCATGTCGCGTATTGATAAT
GGTATGCCCTCTAAACGAAATATCACGCTGGAACAAAAAGGCAGGGGATCGAACCTCCCCGGCGGGGCCA
CACAGTTCTATATTCCAAACCTGACGGTTGGGCATATCAGTAGCCACAACTTTTCAGCCTTGAAATAA