SecReT6
Protein ID: 158512117
SecReT6 ID791
T6SS typei4b
Gene symbolevpJ
Locus tagEvpJ
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]16475..16777 [+]
ProductEvpJ
NotePAAR
UniProt IDA8YQR6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.90E-24, Aligned region: 1..20
PAAR_motif [PF05488], Evalue: 2.90E-24, Aligned region: 24..90
DUF4150 [PF13665], Evalue: 1.40E-06, Aligned region: 35..54
DUF4150 [PF13665], Evalue: 1.40E-06, Aligned region: 59..87
Protein Sequence: 100 a.a.     [Download]
>gi|158512117|ref|ABW69082.1| EvpJ [Edwardsiella tarda]
MGQPAARLTDMHVCPMQTPGVPPVPHVGGPVIGPGVPTVLIGGLPAAVLGDMLTCVGPPDTIIKGSATVL
IGGKPAARMGDSTAHGGTITLGCPTVLIGG
 
Nucleotide Sequence: 303 bp     [Download]
>gi|158512110|gb|AY424360|evpJ|:16475-16777
ATGGGACAACCTGCCGCACGTTTGACGGATATGCACGTTTGCCCGATGCAGACCCCGGGCGTTCCCCCGG
TGCCGCACGTCGGCGGCCCGGTCATCGGCCCCGGCGTTCCCACGGTGCTGATCGGCGGACTGCCGGCGGC
GGTGCTGGGCGACATGCTGACCTGCGTCGGCCCACCCGACACCATTATCAAGGGCAGTGCCACCGTGCTG
ATCGGCGGCAAGCCCGCCGCCCGCATGGGGGACAGCACGGCGCATGGTGGCACGATCACGCTGGGCTGCC
CCACCGTGTTGATTGGCGGCTAA