SecReT6
Protein ID: 158512118
SecReT6 ID791
T6SS typei4b
Gene symbolevpK
Locus tagEvpK
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]16791..17858 [+]
ProductEvpK
NoteTssA
UniProt IDA8YQR7, A8YQR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 56..116
ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 237..252
Herpes_UL17 [PF04559], Evalue: 0.0039, Aligned region: 158..253
Protein Sequence: 355 a.a.     [Download]
>gi|158512118|ref|ABW69083.1| EvpK [Edwardsiella tarda]
MTILDMARLLAPIGEAHPAGEDISFDPLYDQIREARRADADYLGQGEWVSSLKQANWVEVIRLTSEALAT
RSKDLQLAVWLCEALVQRHGLPGLREGLLLLDSLLERYWAEMYPALSDEDLEGRVSRLEWLNQILPPALG
LLPLTAAQDGRAYGWLDWQVSREVDNLKRLNSEAAQAALSEGKLDPDAWDLAVSHTPGAFYLTLQDDLQQ
AIRAFQGLSQRLDPLFGRDAPRISDVAERLEQMLRLVTRLVEGKGVARPREAQERAEAPAGAETAAVNAS
SPGVAGAPRTREEAIRQLSGIAAFFKETEPHSPVSYIVDKAARWGNMRLDEWIREVVEDDGTRRMLKGVL
GYDEE
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|158512110|gb|AY424360|evpK|:16791-17858
ATGACTATCTTAGATATGGCGCGCTTGCTGGCCCCGATCGGTGAAGCTCATCCGGCGGGAGAGGATATCA
GCTTCGACCCGCTGTATGACCAGATTCGGGAGGCCCGCCGGGCCGATGCCGACTACCTTGGGCAGGGAGA
GTGGGTCAGCTCGCTCAAGCAGGCCAACTGGGTCGAGGTGATCCGCCTGACCAGCGAGGCGCTGGCGACG
CGCAGCAAAGATCTGCAGCTGGCGGTGTGGCTGTGCGAAGCCCTGGTGCAGCGGCATGGGCTGCCGGGGC
TGCGCGAGGGGCTGCTGTTGCTGGATAGCCTGCTGGAGCGCTATTGGGCGGAGATGTATCCGGCGCTGAG
CGACGAGGATCTGGAGGGGCGGGTGAGCCGTCTGGAGTGGCTCAATCAGATCCTTCCCCCGGCGCTGGGC
TTGCTGCCCCTGACGGCCGCCCAGGATGGACGCGCCTACGGCTGGCTGGATTGGCAGGTCTCCCGAGAGG
TCGATAACCTGAAGCGGCTGAACAGTGAGGCGGCTCAGGCGGCCCTCAGCGAAGGAAAGCTGGATCCGGA
TGCCTGGGATCTCGCCGTCAGCCATACGCCCGGCGCCTTTTACCTGACGTTACAGGACGATCTGCAGCAG
GCCATCCGCGCATTCCAGGGATTATCCCAGCGGCTCGACCCCCTATTTGGGCGGGATGCCCCGCGGATCA
GCGATGTGGCTGAGCGGCTGGAGCAGATGCTCAGGCTGGTGACGCGGCTGGTAGAGGGTAAGGGCGTGGC
GCGACCCCGCGAGGCCCAGGAGCGCGCAGAGGCGCCGGCGGGCGCAGAGACCGCCGCGGTTAACGCCTCC
TCTCCCGGCGTGGCCGGCGCCCCCCGAACCCGCGAGGAGGCCATTCGGCAGCTCAGCGGCATCGCCGCGT
TTTTCAAGGAGACCGAACCGCACAGCCCCGTCTCCTACATCGTGGATAAAGCCGCCCGCTGGGGCAATAT
GCGACTGGATGAGTGGATCCGAGAGGTGGTGGAAGATGACGGCACCCGGCGGATGCTCAAAGGTGTATTG
GGCTATGATGAAGAATAA