SecReT6
Protein ID: 158512119
SecReT6 ID791
T6SS typei4b
Gene symbolevpL
Locus tagEvpL
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]17779..18486 [+]
ProductEvpL
NoteTssJ
UniProt IDA8YQR8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-19, Aligned region: 38..199
Protein Sequence: 235 a.a.     [Download]
>gi|158512119|ref|ABW69084.1| EvpL [Edwardsiella tarda]
MSGSERWWKMTAPGGCSKVYWAMMKNKAIWSAIGCLLLSLSGCTSDAAKQQARSSVSWRYGSQAILVNAQ
TAPDLNSYDGESHSLVLAVVQTRSPDAFYQLIQTPELAGLVLQGGRPPDGILQVSRYALEPGHAFRLVLD
RLQEARQVGFIAAFYGLPLTQTSRLFDIPVSVTRSGILFPDWQAAPSPLALDLKLGNSGIGEAESHPLER
IPAAPDPASAPTAATPIRLSNSGEP
 
Nucleotide Sequence: 708 bp     [Download]
>gi|158512110|gb|AY424360|evpL|:17779-18486
ATGAGTGGATCCGAGAGGTGGTGGAAGATGACGGCACCCGGCGGATGCTCAAAGGTGTATTGGGCTATGA
TGAAGAATAAGGCGATCTGGAGTGCCATCGGCTGCCTGCTGCTCAGCCTGAGCGGCTGCACCTCCGACGC
GGCAAAGCAGCAGGCCCGCAGCAGCGTATCCTGGCGGTACGGCAGCCAGGCCATCTTGGTGAATGCACAA
ACCGCCCCGGATCTGAACAGCTACGACGGCGAGTCGCACAGCCTGGTGCTGGCGGTGGTGCAGACTCGCT
CGCCGGACGCCTTCTATCAGTTAATCCAAACCCCCGAACTCGCCGGCCTCGTCTTGCAGGGCGGGCGTCC
CCCTGACGGAATTTTGCAGGTAAGCCGCTATGCCCTGGAGCCCGGCCACGCTTTCCGCCTGGTCCTGGAT
CGCCTGCAGGAGGCGCGCCAGGTGGGGTTCATCGCCGCGTTCTACGGCCTGCCGCTAACGCAGACCTCCC
GCCTGTTTGATATCCCGGTCAGCGTGACCCGCTCGGGGATACTGTTCCCGGACTGGCAAGCTGCCCCCTC
CCCCCTGGCGCTGGACCTGAAGCTGGGGAACAGCGGGATCGGCGAGGCGGAGAGCCATCCGCTGGAGCGC
ATTCCCGCGGCCCCCGATCCGGCCAGCGCGCCGACGGCGGCTACGCCGATCCGGCTGAGCAATAGCGGCG
AACCCTAG