SecReT6
Protein ID: 158512120
SecReT6 ID791
T6SS typei4b
Gene symbolevpM
Locus tagEvpM
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]18585..19973 [+]
ProductEvpM
NoteTssK
UniProt IDA8YQR9, A8YQR9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.30E-90, Aligned region: 19..460
Protein Sequence: 462 a.a.     [Download]
>gi|158512120|ref|ABW69085.1| EvpM [Edwardsiella tarda]
MKIHKPVYWHQGMFLQPQHFQLADLHSQFQLKPFLDSGLQDFWGVGALTISESALGNQQLNILSAELLFR
DHSYVVWPGNTICKPRSFASAWQDQSRPFNVYLGLKKLDTIESNVAVVPQLEDGAGRNVRCVTTQQGDKH
ADLYSDGPEAEIQSLHYVLQVLWESEVEKLTDYNILPIARLERQGEVVQLSKSFIPPCYIMGGSETLMRV
VRDVRDDLAGRARQLEAYKSPREIRKAEFDASFLMFLLALRTLNRYVPLLYQLTESPQVHPRKVYDVLRQ
IVGELSTFSERCDMLGSSGENSPGLPPYRHQDIAPGLLTVRDLIIRLLNEISIGPDFLIALEPSGEYLTA
RLPKSLLEDRNRFYLIVRSDMAPDTLQAAFRARARLAEADALPLLIQRALPGITLTPLSSVPEGLPRRSC
SFYFQIDTQSEAWRQVAESCHVAFNWFDAPDDLKVELVGVSR
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|158512110|gb|AY424360|evpM|:18585-19973
ATGAAAATTCACAAACCAGTTTATTGGCATCAGGGCATGTTTTTACAGCCGCAGCATTTTCAGCTGGCAG
ACCTGCATAGCCAATTTCAGCTCAAGCCATTCTTGGACTCCGGACTGCAGGATTTTTGGGGAGTGGGAGC
GCTGACCATTTCGGAGTCAGCCCTAGGCAACCAGCAGCTCAATATCCTGTCGGCTGAGCTGCTCTTCCGC
GACCACAGCTATGTCGTATGGCCGGGCAATACCATCTGTAAGCCGCGCTCCTTCGCCTCTGCCTGGCAGG
ATCAGAGCCGGCCGTTCAATGTCTACTTGGGGCTGAAAAAGCTGGACACGATAGAGTCCAATGTGGCCGT
CGTGCCACAGCTTGAGGATGGCGCAGGGCGGAACGTCCGCTGCGTGACGACCCAGCAGGGAGACAAGCAC
GCGGACTTATATTCGGATGGGCCTGAAGCCGAGATCCAGAGCCTGCACTACGTGCTGCAGGTGCTGTGGG
AGAGCGAGGTTGAAAAGCTGACGGATTACAATATCCTGCCCATCGCCCGGCTGGAGCGCCAGGGCGAGGT
GGTTCAGCTGTCCAAGAGCTTCATTCCGCCGTGCTACATCATGGGCGGCTCCGAGACCCTGATGCGGGTG
GTCCGGGATGTCCGGGACGATCTGGCGGGGCGCGCCCGCCAGCTGGAGGCCTATAAAAGCCCGCGCGAAA
TCCGCAAGGCGGAGTTCGATGCCAGCTTTCTGATGTTTCTGCTGGCCCTGCGCACCCTCAACCGCTACGT
GCCGCTGCTGTACCAGCTGACCGAATCGCCGCAGGTCCATCCGCGCAAGGTCTACGACGTGCTGCGGCAG
ATCGTCGGCGAGCTGTCCACCTTCAGCGAGCGCTGCGACATGCTGGGCTCCAGCGGCGAAAACAGCCCGG
GGCTCCCCCCCTACCGCCATCAGGACATCGCGCCGGGGCTGTTAACCGTACGCGATCTGATTATTCGTTT
ATTGAATGAAATATCGATCGGACCCGATTTCCTGATCGCCCTGGAGCCGAGCGGGGAGTACCTGACGGCG
CGGCTCCCCAAGAGCCTGCTGGAAGATCGTAACCGCTTCTACCTGATCGTCCGCAGTGACATGGCGCCGG
ATACCCTGCAGGCCGCGTTCCGGGCCCGCGCCAGACTGGCCGAGGCCGACGCATTGCCCTTACTGATCCA
GCGCGCCTTGCCGGGGATCACGCTGACGCCGCTATCGTCCGTTCCCGAAGGCTTGCCCCGGCGCTCCTGC
TCGTTTTATTTCCAGATCGATACCCAAAGTGAAGCCTGGCGGCAGGTCGCCGAGAGTTGCCACGTCGCGT
TCAACTGGTTCGATGCCCCAGATGACCTCAAAGTAGAATTGGTAGGAGTGAGCCGGTGA