SecReT6
Protein ID: 158512121
SecReT6 ID791
T6SS typei4b
Gene symbolevpN
Locus tagEvpN
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]19970..20620 [+]
ProductEvpN
NoteTssL
UniProt IDA8YQS0, A8YQS0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.70E-40, Aligned region: 2..204
Protein Sequence: 216 a.a.     [Download]
>gi|158512121|ref|ABW69086.1| EvpN [Edwardsiella tarda]
MSLSEAFIQPMLYVRQYLQAPEGEPSLFRERLQSYLHHSQLRAQEAGESPAAIDSALYAVVAWMDETIMC
STWDGVATWRRDPLQASYFNTVCAGVDFFDKLTALSPEADDVREVYLLCLALGFEGRYAGPTGQTALTQI
RVHQLRDLHGEVWEASRRLFPEAYPRSSVTPTQQTRWLTQSRFTTVVVPLVILVALYGILNWVLYEYADL
ALEWLP
 
Nucleotide Sequence: 651 bp     [Download]
>gi|158512110|gb|AY424360|evpN|:19970-20620
GTGAGTTTATCGGAAGCGTTTATTCAGCCCATGCTCTACGTGCGGCAGTATCTCCAGGCGCCCGAAGGCG
AGCCGTCATTATTCCGTGAGCGGCTGCAGTCATACCTGCACCACAGCCAGCTCCGGGCCCAAGAGGCGGG
GGAAAGTCCGGCCGCGATCGACTCCGCCCTGTATGCCGTTGTGGCCTGGATGGATGAGACCATCATGTGT
TCGACGTGGGACGGCGTGGCGACATGGCGACGTGACCCCCTGCAGGCCAGCTACTTCAACACCGTCTGCG
CCGGGGTTGACTTCTTCGACAAGCTGACCGCCCTGAGCCCCGAGGCCGATGACGTCAGGGAGGTCTATCT
GCTGTGCCTGGCCCTGGGATTTGAGGGGCGCTATGCCGGCCCGACGGGCCAGACCGCGCTGACGCAGATC
AGGGTGCACCAGCTGAGGGATCTGCACGGCGAGGTATGGGAGGCGTCGCGGCGTTTATTTCCAGAGGCCT
ACCCGAGATCCTCGGTCACGCCGACGCAGCAAACGCGATGGCTGACCCAAAGCCGCTTTACCACCGTCGT
CGTGCCGCTGGTCATCCTGGTCGCCCTGTACGGCATTTTAAACTGGGTATTATATGAATACGCGGATCTC
GCGCTGGAGTGGCTGCCATGA