SecReT6
Protein ID: 158512125
SecReT6 ID791
T6SS typei4b
Gene symbolevpF
Locus tagEvpF
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]8800..10641 [+]
ProductEvpF
NoteTssF
UniProt IDQ6EE16, Q6EE16
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-214, Aligned region: 4..611
Protein Sequence: 613 a.a.     [Download]
>gi|158512125|ref|AAS58124.4| EvpF [Edwardsiella tarda]
MVELLPYYNRELAFLRQLGREFASQYPKVAGRLLLEEGVSEDPHVERLIEAVAFLCARVHHKIDEQFPEI
TNALLGILYPHYLRPIPSLSLVQFSVDPAQTNLSGPLRLPRHTSLLSRQVDGMACRFRTAYPVEIWPVSV
IHAGFAPARQTSLSVQQQGSAGLICIRLQTHPGHHLNTLGMDRLRFFLQGEPAVVHTLYELLFNNVTKVV
LRAGSAEWTLPASIISPVGFDEDESLFDYDARSSQAYRLLHEYFAFPDKFLFFDMTELLQATPLPEACRE
IDLVIHLSAFEREGRLAKLTDTIDASTFRLGCSPVVNLFRQRAEPLQVTHRKTEYPIIPDVRRPWGMEVY
SVDAVSKLVKHDGQEKIKRYRPLFGLHHANDSEPQRVFWMENRRGGIRGDDPGMDVYLSLVDLDFDPNQS
SSETLSIDVTCTNREFPSLLPFGGDRGDFEVDGGSPVTRIHCLRKPTPTLRPAHGRAAMWRLISHLNLNL
LSITGENEEATEAFRELLGLYNFSDSPALRQQIAGIVSINSQPATARLCSRNQAAVVRGIEITLVLDESQ
FEGSGVYLFSAVVERFVSQYGAINSFTRLHVRTRQREQALKRWPPRAGKAVLS
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|158512110|gb|AY424360|evpF|:8800-10641
ATGGTCGAGCTATTGCCCTACTATAACCGGGAGCTGGCGTTCTTACGTCAGTTGGGACGTGAGTTCGCCT
CCCAGTATCCCAAGGTGGCCGGACGCCTTCTGCTGGAGGAGGGGGTCTCGGAAGATCCCCATGTCGAACG
GCTGATCGAGGCCGTGGCATTTCTCTGCGCTCGAGTGCACCACAAGATTGATGAGCAGTTTCCCGAAATT
ACCAATGCGCTGCTGGGGATCCTGTATCCCCACTACCTGCGCCCGATCCCCTCGCTATCCCTGGTTCAGT
TTTCGGTCGATCCGGCGCAGACCAACCTATCGGGCCCACTGCGCCTGCCGCGGCATACCAGCCTGCTGTC
TCGCCAGGTGGATGGCATGGCATGCCGGTTTCGCACCGCCTACCCGGTGGAGATTTGGCCCGTGTCGGTC
ATCCATGCCGGCTTCGCCCCCGCGCGGCAAACCAGCCTGTCCGTGCAGCAGCAGGGAAGCGCCGGTCTGA
TCTGTATCCGCCTACAAACCCACCCGGGACATCATCTGAATACCCTGGGGATGGATAGACTGCGCTTCTT
TCTCCAGGGGGAGCCAGCCGTGGTGCACACCCTGTATGAGCTGCTGTTCAACAACGTGACCAAGGTGGTG
CTCCGCGCCGGATCGGCGGAGTGGACCCTGCCGGCCAGCATCATCTCACCGGTCGGATTTGACGAGGATG
AGAGCCTGTTTGACTACGATGCCCGCTCGTCCCAGGCCTACCGCTTACTGCACGAATACTTTGCCTTTCC
CGACAAGTTCCTGTTTTTTGACATGACCGAGCTGCTGCAGGCCACCCCGCTGCCGGAGGCCTGCCGGGAG
ATCGATCTGGTGATCCATCTGTCGGCGTTCGAGCGAGAGGGGCGCCTGGCCAAACTGACCGATACCATCG
ACGCCTCCACCTTTCGGCTGGGATGCAGCCCGGTGGTCAACCTGTTCCGGCAGCGGGCAGAGCCGTTGCA
GGTAACCCACCGTAAAACCGAGTACCCGATTATTCCCGATGTCCGCCGCCCCTGGGGCATGGAGGTCTAT
TCGGTCGATGCCGTCAGCAAGCTGGTCAAGCATGACGGGCAGGAGAAGATAAAACGCTACCGCCCCCTGT
TTGGCCTGCATCACGCCAACGACAGTGAGCCGCAGCGGGTATTCTGGATGGAAAACCGCCGCGGTGGGAT
CCGCGGGGATGACCCGGGCATGGATGTCTACTTATCCCTGGTGGATTTGGATTTTGACCCCAATCAGTCA
TCGTCGGAAACCCTGAGTATCGACGTGACCTGCACCAACCGAGAGTTTCCGTCCCTGCTGCCCTTCGGCG
GCGACCGGGGCGATTTCGAGGTGGACGGCGGCTCTCCCGTCACTCGCATCCACTGCCTGCGCAAGCCGAC
GCCCACCCTGCGCCCGGCCCACGGCAGGGCCGCCATGTGGCGTCTGATCTCCCACCTGAACCTGAACCTG
CTCTCCATCACCGGCGAAAACGAGGAGGCGACCGAGGCCTTCAGGGAGCTGCTCGGACTGTATAACTTCA
GCGACTCCCCCGCCCTGCGTCAGCAGATTGCCGGCATTGTCAGTATCAACAGCCAGCCGGCGACGGCGCG
CCTGTGCAGCCGGAATCAGGCGGCGGTGGTGCGGGGCATCGAAATCACCCTGGTGCTGGACGAGAGCCAA
TTTGAGGGCTCCGGGGTGTACCTGTTCAGCGCCGTGGTGGAGCGATTCGTCAGCCAGTACGGCGCCATCA
ACAGCTTTACCCGCCTGCACGTCCGCACCCGGCAGCGGGAACAGGCGCTCAAGCGCTGGCCGCCGCGGGC
GGGCAAGGCGGTGCTGTCATGA