SecReT6
Protein ID: 158512126
SecReT6 ID791
T6SS typei4b
Gene symbolevpG
Locus tagEvpG
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]10638..11663 [+]
ProductEvpG
NoteTssG
UniProt IDQ6EE15, Q6EE15
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.10E-100, Aligned region: 16..317
Protein Sequence: 341 a.a.     [Download]
>gi|158512126|ref|AAS58125.4| EvpG [Edwardsiella tarda]
MNDALSPKSVLEQLYARPYEFDFFQAVRILELQQLRCGCQELPLRFRTHLSLATPASSVYALQPPAADQP
QVMTINFMGLTGPSGALPTRYTEMLLARRLQHRDQTAHHFFDLLNHRLITLFYQAWRKHQATADLECGLQ
ADWRQMLLSLAGLGTLGLQNRLKKDGVNDDVFAYYAGRFGTRSLSEEGLRTLLTDYFSVPVEILPFQGRW
LKLDEADLLTLGRQNCTLGEWPVLGRQVWDAQSQFRIRLGPMSYQQFQPFLPGGKDFRALTKLVRFAIEI
AVTFDIQLVLAASEVPPCTLGDSQAGAARPGWIGWLGGRPARLGDADEVVLQASESGKPAR
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|158512110|gb|AY424360|evpG|:10638-11663
ATGAACGACGCCCTGAGCCCAAAGTCCGTGCTGGAGCAGCTGTATGCGCGGCCCTATGAGTTCGATTTTT
TTCAGGCCGTCAGGATACTGGAGCTGCAGCAGCTACGGTGTGGCTGCCAGGAGCTTCCGCTGCGCTTCCG
GACGCATCTCTCCCTGGCCACCCCGGCCAGCAGTGTCTATGCGCTGCAGCCGCCCGCGGCAGACCAGCCG
CAGGTCATGACCATCAACTTCATGGGGCTGACCGGTCCCTCTGGGGCGCTGCCGACGCGGTATACCGAGA
TGCTGCTGGCGCGTCGCCTGCAGCATCGGGATCAGACCGCCCACCACTTTTTTGATCTGCTCAATCACCG
TCTGATCACCCTGTTTTACCAGGCATGGCGCAAGCATCAGGCGACGGCCGATCTGGAGTGCGGCCTGCAG
GCCGACTGGCGCCAGATGCTGCTCTCCCTGGCCGGTCTGGGCACGCTGGGCCTGCAGAATCGGCTGAAAA
AAGACGGCGTCAATGACGATGTCTTTGCCTATTACGCCGGACGGTTCGGCACCCGCTCGCTCAGCGAGGA
GGGGCTGCGCACGCTGCTGACAGACTATTTTTCCGTGCCGGTCGAGATCCTGCCCTTTCAGGGCCGCTGG
CTGAAGCTGGATGAGGCGGACCTCCTCACTCTGGGGCGCCAAAACTGCACTCTGGGAGAGTGGCCGGTGC
TGGGGCGACAGGTATGGGATGCCCAAAGCCAGTTTAGGATCCGCCTCGGCCCCATGAGCTATCAGCAGTT
TCAGCCATTTTTGCCGGGGGGCAAGGACTTTCGGGCGCTGACCAAGCTGGTCCGTTTTGCCATCGAGATC
GCCGTCACATTCGATATTCAGCTGGTGCTGGCCGCCAGCGAGGTCCCCCCCTGCACGCTGGGCGATAGTC
AGGCCGGGGCGGCCCGTCCCGGATGGATTGGCTGGCTGGGAGGCCGTCCCGCCAGGCTGGGGGATGCCGA
CGAAGTGGTATTGCAGGCGTCAGAGTCCGGGAAGCCCGCGCGATAA