SecReT6
Protein ID: 158512127
SecReT6 ID791
T6SS typei4b
Gene symbolevpH
Locus tagEvpH
StrainEdwardsiella tarda PPD130/91
Repliconchromosome [GenBank: AY424360] [Browse all T6SS(s) in this replicon]
Location [Strand]11782..14394 [+]
ProductEvpH
NoteTssH
UniProt IDQ6EE14, Q6EE14
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.10E-39, Aligned region: 219..241
AAA_2 [PF07724], Evalue: 2.10E-39, Aligned region: 598..765
AAA [PF00004], Evalue: 1.00E-18, Aligned region: 219..349
AAA [PF00004], Evalue: 1.00E-18, Aligned region: 604..688
AAA_5 [PF07728], Evalue: 4.20E-14, Aligned region: 219..252
AAA_5 [PF07728], Evalue: 4.20E-14, Aligned region: 603..720
ClpB_D2-small [PF10431], Evalue: 2.20E-13, Aligned region: 775..845
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 196..239
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 263..298
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 429..523
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 597..648
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 668..692
AAA_16 [PF13191], Evalue: 1.30E-09, Aligned region: 745..794
Clp_N [PF02861], Evalue: 1.50E-09, Aligned region: 24..74
Clp_N [PF02861], Evalue: 1.50E-09, Aligned region: 107..132
AAA_22 [PF13401], Evalue: 5.40E-09, Aligned region: 218..314
AAA_22 [PF13401], Evalue: 5.40E-09, Aligned region: 366..385
AAA_22 [PF13401], Evalue: 5.40E-09, Aligned region: 601..691
AAA_19 [PF13245], Evalue: 2.30E-05, Aligned region: 219..241
AAA_19 [PF13245], Evalue: 2.30E-05, Aligned region: 601..625
Sigma54_activat [PF00158], Evalue: 3.20E-05, Aligned region: 214..234
Sigma54_activat [PF00158], Evalue: 3.20E-05, Aligned region: 603..703
AAA_14 [PF13173], Evalue: 3.40E-05, Aligned region: 219..353
AAA_14 [PF13173], Evalue: 3.40E-05, Aligned region: 602..684
AAA_14 [PF13173], Evalue: 3.40E-05, Aligned region: 777..832
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 219..243
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 275..314
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 343..386
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 601..625
AAA_17 [PF13207], Evalue: 6.20E-05, Aligned region: 219..284
AAA_17 [PF13207], Evalue: 6.20E-05, Aligned region: 602..638
AAA_17 [PF13207], Evalue: 6.20E-05, Aligned region: 788..818
IstB_IS21 [PF01695], Evalue: 8.70E-05, Aligned region: 203..278
IstB_IS21 [PF01695], Evalue: 8.70E-05, Aligned region: 603..622
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 219..287
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 605..628
Zeta_toxin [PF06414], Evalue: 0.00015, Aligned region: 219..239
Zeta_toxin [PF06414], Evalue: 0.00015, Aligned region: 466..498
Zeta_toxin [PF06414], Evalue: 0.00015, Aligned region: 602..643
NACHT [PF05729], Evalue: 0.00021, Aligned region: 219..246
NACHT [PF05729], Evalue: 0.00021, Aligned region: 603..628
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 211..235
AAA_29 [PF13555], Evalue: 0.001, Aligned region: 601..628
Hpr_kinase_C [PF07475], Evalue: 0.0027, Aligned region: 219..231
Hpr_kinase_C [PF07475], Evalue: 0.0027, Aligned region: 601..622
DUF815 [PF05673], Evalue: 0.007, Aligned region: 213..294
DUF815 [PF05673], Evalue: 0.007, Aligned region: 603..643
DUF2075 [PF09848], Evalue: 0.0096, Aligned region: 219..321
DUF2075 [PF09848], Evalue: 0.0096, Aligned region: 369..385
DUF2075 [PF09848], Evalue: 0.0096, Aligned region: 602..629
Protein Sequence: 870 a.a.     [Download]
>gi|158512127|ref|AAS58126.4| EvpH [Edwardsiella tarda]
MNTDLKALTGKMNQTCHQALEAAAGLCLARGHHEVDIEHVLLKLLETDNTDLARLLQHYGVDAGRFQRDI
ERALDRLKGGCSRQPMLSPHLPRLLSGAWLMASVNCGESQIRSGHLIMALLDDAVLQQLARAMSPEWAAW
SAADLLHQWPALVAGSREATTMSTPGPHAGASPSPALDQYTVNLSERARQGQLDPVLGRDSEIRQMIDIL
LRRRQNNPILTGEAGVGKTAVVEGLALRIAAGEVPDSLRNVALRMLDLGLLQAGASVKGEFERRLKAVID
EVKACSEPVILFIDEAHTLIGAGGAAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQ
AIKVEEPSEEIAMVMLRGMLTKMRQHHQVRILDEAVTAAVRLSHRYLTGRQLPDKAVSVLDTACARIALG
QRTLPAPVEDACRHLEHLQTEITLLEQEQASGLDHGRRLETLQEQARVAREHYQTLEQRWIAECDQVAVI
QALQAQLEQEDGPARAEGLTQLEQAVLALEQMQGRAPLVQTCVDESAIAAVISAWTGIPLGKMVQDELEM
VRQLQTRLAERVIGQPYALETIARGIRLSRAGLEDPNKPIGVFLLVGSSGVGKTETALALAETLYGGERN
LITINLSEFQEAHTVSTLRGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLELFFQVFDKGV
MDDAEGREINFRNTVILLTSNVGSDTLMAYCQDGMTPPEPALLCEALRDELIQTFKPAFLGRLQVVPYYP
VRGAVLKQIIRLKLDKIARRFQRNHQATFHYDEALVEGIAERCTQPESGARLIDNILSAQLLSDMADAVL
ARMAAGEPVSDITVSMDEHGRLTGSLEGSD
 
Nucleotide Sequence: 2613 bp     [Download]
>gi|158512110|gb|AY424360|evpH|:11782-14394
GTGAATACAGATTTGAAAGCCTTGACGGGAAAAATGAACCAGACCTGCCATCAGGCGCTGGAGGCAGCGG
CGGGCCTGTGCCTGGCGCGGGGCCATCACGAGGTCGATATCGAGCACGTGCTGCTCAAGCTGCTGGAGAC
CGACAACACGGATCTGGCGCGCCTGCTGCAGCACTATGGGGTCGACGCCGGCCGTTTTCAGCGGGACATT
GAGCGGGCGCTGGATCGCCTGAAGGGCGGATGCAGCCGGCAGCCGATGCTCTCCCCCCACCTGCCGCGGC
TGCTGTCTGGTGCCTGGCTGATGGCCTCCGTCAACTGTGGCGAGAGCCAGATCCGCAGCGGTCATCTGAT
CATGGCGCTGCTGGATGACGCGGTGCTGCAGCAGCTCGCCAGGGCGATGTCGCCCGAGTGGGCGGCGTGG
TCAGCGGCAGATCTGCTGCACCAGTGGCCCGCGCTGGTCGCGGGCAGTCGAGAGGCGACGACGATGAGCA
CGCCGGGGCCGCACGCGGGTGCATCTCCCTCGCCCGCCCTGGATCAATACACGGTAAACCTGAGCGAGCG
GGCCCGCCAGGGCCAGCTGGACCCGGTTCTCGGGCGGGATAGCGAGATTCGGCAGATGATCGATATTTTG
CTGCGCCGCAGGCAGAACAACCCGATTCTTACCGGTGAGGCCGGCGTAGGGAAAACCGCCGTGGTTGAGG
GGCTGGCCCTGCGCATTGCAGCCGGCGAGGTGCCGGATAGCCTGCGCAACGTTGCCCTGCGGATGCTGGA
TCTGGGCCTGCTGCAGGCGGGCGCCAGCGTCAAGGGTGAGTTCGAGCGGCGTCTCAAGGCGGTCATCGAC
GAGGTGAAGGCCTGCAGTGAGCCGGTCATTTTGTTCATCGATGAAGCCCATACGCTGATCGGCGCGGGAG
GCGCGGCGGGTCAGAATGATGCCGCCAATCTGCTGAAGCCGGCGCTGGCCCGCGGTGAGCTGCGCACCAT
TGCCGCCACCACCTGGAGCGAGTACAAAAAATATTTCGAGAAAGATCCCGCCCTGGCGCGGCGCTTCCAG
GCCATCAAGGTGGAGGAGCCCAGCGAGGAGATCGCCATGGTGATGCTGCGCGGCATGCTGACCAAAATGC
GCCAGCACCACCAGGTCCGGATTCTGGATGAGGCGGTGACGGCCGCCGTCAGGCTGTCACACCGCTATTT
GACCGGCAGACAGCTGCCGGACAAGGCGGTCAGCGTGCTGGATACCGCCTGCGCCCGCATTGCGCTCGGG
CAGCGTACCCTGCCGGCCCCCGTCGAGGATGCCTGCCGCCATCTGGAGCATCTCCAGACCGAGATCACGC
TGCTGGAGCAGGAGCAGGCCAGCGGCCTCGATCATGGTCGCCGCCTGGAGACGCTGCAGGAGCAGGCCCG
GGTCGCCCGGGAGCACTATCAGACCCTGGAGCAGCGCTGGATCGCGGAGTGTGATCAGGTCGCCGTCATT
CAGGCGCTGCAAGCGCAGCTGGAGCAGGAGGATGGCCCGGCGCGCGCTGAGGGGCTGACCCAGCTGGAGC
AGGCCGTTTTGGCGCTTGAGCAGATGCAGGGCCGGGCGCCGCTGGTGCAGACCTGTGTGGATGAGTCCGC
CATTGCGGCGGTGATCTCGGCATGGACGGGGATTCCGCTGGGCAAGATGGTTCAGGATGAGCTGGAGATG
GTTCGCCAGCTGCAGACGCGGCTGGCCGAGCGGGTCATCGGGCAGCCCTATGCCCTGGAGACCATCGCCC
GGGGGATTCGCCTGTCCCGCGCGGGGCTCGAGGATCCCAACAAGCCCATCGGCGTGTTTCTGCTGGTCGG
CTCCAGCGGCGTGGGAAAGACCGAGACCGCGCTGGCGCTGGCCGAAACCCTGTATGGCGGCGAGCGCAAC
CTGATCACCATCAACCTGTCGGAGTTTCAGGAGGCCCATACCGTTTCGACGCTGCGGGGCTCGCCGCCGG
GCTACGTCGGCTACGGAGAGGGCGGCGTGCTGACGGAGGCGGTACGCCGCAAACCCTACAGTGTGGTGCT
GCTGGATGAGGTGGAGAAAGCCCACCCGGATGTCCTGGAGCTGTTCTTCCAGGTGTTTGACAAGGGGGTC
ATGGACGATGCCGAGGGGCGGGAGATCAACTTCCGCAATACCGTCATACTGCTGACCTCCAACGTCGGCA
GCGACACCCTGATGGCCTACTGTCAGGACGGCATGACGCCGCCCGAACCGGCGCTGCTGTGTGAGGCGCT
GCGGGATGAGCTGATCCAGACCTTCAAGCCGGCCTTCCTCGGACGCCTGCAGGTAGTGCCCTACTACCCG
GTGCGGGGCGCGGTGCTAAAACAGATTATCCGCCTCAAGCTGGATAAGATTGCCCGCCGCTTCCAGCGCA
ATCATCAGGCCACCTTCCATTACGATGAGGCCCTGGTGGAGGGCATCGCCGAGCGCTGTACCCAGCCGGA
GAGCGGCGCCCGCCTGATCGATAACATTCTGTCGGCCCAGCTGCTGTCCGATATGGCGGACGCGGTGCTG
GCGCGCATGGCCGCCGGTGAGCCGGTGTCCGATATCACCGTCTCAATGGATGAGCACGGCCGACTGACGG
GATCGTTAGAGGGGAGTGACTGA