SecReT6
Protein ID: 15890635
SecReT6 ID16
T6SS typei5
Gene symbolvgrG
Locus tagAtu4348
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1481495..1483945 [+]
ProductVgrG protein
NoteTssI
UniProt IDA9CGH0
KEGG IDatu:Atu4348
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-61, Aligned region: 36..346
Phage_base_V [PF04717], Evalue: 7.00E-19, Aligned region: 216..244
Phage_base_V [PF04717], Evalue: 7.00E-19, Aligned region: 385..478
Protein Sequence: 816 a.a.     [Download]
>gi|15890635|ref|NP_356307.1| VgrG protein [Agrobacterium tumefaciens str. C58]
MNDQPSVSDFVQASRVLKVSSPLGEDQLLPERLSVEEGVSQLFEIRLTVRAKKEAVKPEELIGRLVDVSI
EISQGDGDGGGVRRPFNGLVTELHEGPPITRGMRSYALTIRPQMWLLSRRSDCRIWMDKTAVEIVETLFS
EHGIPAPDTSGIISPPPAQHYSVQFNETDLDYLTRRFEEDGLFYWFSHEDGSHKLHVADSASGWLGPSPA
AQGEGMVRLAQGSSDRNHINDWARRFSYVSGQRAGADWNFETPGMVPGTMTPSLVQMPDATKRELYEYPA
RIKTVEEAERAQKLRTQAIEADHDRVFGSSTTRILEAGRRFTPFEVAHPEHAYEEHVIVRASHSIVDLSY
ETNSNEPEYRNHFEAIPARVPLTPHRSTKRPRIEGTQVAIVAGPEGEEIHPDQYGRIKLWFPWDRKAKKD
GTDTCWVRVSQAWGGGTWGAQVIPRIGMEVMVAFVDGDPDKPLVIGVVNNPANSVPYDLPANKTRMVLRS
NSHKGDGFNEITFEDEAGKENQFFHAQKDQTTRVLNDRTKRIDRHEVASVGGNRAVEVSGNQKHEIGGSV
NTVVGGTGPMAMMAMAGVQALSGQTAGLLSQAAQIAGGGGPGVAAFATTLASSALGFLGAGGLSSREGVV
SGPSPRADAGTALAGSGSGVGSDASGLFPLPGIMNTIIGAFQSTSVGVAKAEQVGVSKVTNIGQTEVRQV
GKQQNLTIGKEQFVEIGTGQYTRVGEKITINVGKLYNLVSEEKYHGEAKVWEIFADDEIRLSTPGGYISL
TKSGIKLFALKIDIEGNQINFKKGGPGESGSCLKSMSKNSTPFVRI
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|159185562|ref|NC_003063.2|:1481495-1483945 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGAACGACCAGCCTTCGGTTTCTGATTTCGTTCAGGCGAGCCGTGTTCTGAAAGTGTCTTCGCCCTTGG
GCGAGGACCAGCTTCTGCCGGAACGCCTGTCCGTCGAGGAGGGCGTGTCGCAGCTCTTCGAGATCCGCCT
GACCGTGCGAGCCAAGAAGGAAGCGGTGAAGCCCGAGGAACTGATCGGACGGCTGGTCGATGTCTCGATC
GAGATAAGCCAGGGCGATGGTGATGGCGGCGGCGTTCGCCGCCCCTTCAACGGCCTGGTGACGGAATTGC
ATGAAGGGCCGCCGATTACCCGTGGCATGCGCTCCTATGCGCTGACCATCCGGCCGCAGATGTGGCTGCT
GTCGCGCCGCTCCGATTGCCGCATCTGGATGGACAAGACGGCGGTCGAGATCGTCGAGACGCTGTTTTCC
GAACATGGCATTCCCGCCCCCGATACATCGGGCATCATTTCACCGCCGCCTGCCCAGCACTACAGCGTTC
AGTTTAACGAGACGGATCTCGATTATCTCACTCGCCGTTTCGAAGAGGACGGCCTGTTTTACTGGTTCAG
CCACGAGGACGGGTCCCACAAGCTGCATGTGGCCGATAGCGCCAGCGGCTGGCTCGGACCATCACCGGCC
GCACAGGGCGAGGGAATGGTGCGCCTGGCGCAGGGCTCGTCGGACCGTAACCACATCAACGACTGGGCGC
GACGGTTCTCCTATGTCTCGGGCCAGCGCGCGGGTGCGGACTGGAATTTCGAGACACCGGGCATGGTGCC
GGGCACGATGACGCCATCGCTGGTGCAGATGCCGGATGCGACGAAGCGCGAGCTTTACGAATATCCAGCC
CGCATCAAGACAGTGGAAGAAGCGGAACGGGCGCAGAAACTGCGGACCCAGGCAATTGAGGCCGATCATG
ACCGGGTGTTCGGCTCATCGACCACGCGTATTCTGGAAGCGGGCCGTCGCTTCACGCCTTTCGAGGTTGC
GCATCCCGAGCATGCCTACGAGGAGCATGTGATCGTGAGGGCAAGCCACAGTATTGTTGATCTCTCCTAT
GAGACAAACAGCAACGAACCGGAGTACCGCAATCACTTCGAGGCAATTCCCGCCCGCGTGCCGCTGACGC
CGCACCGGTCAACCAAACGGCCGCGCATCGAAGGCACGCAGGTGGCGATCGTCGCCGGCCCCGAAGGCGA
GGAAATCCATCCGGATCAATATGGCCGCATCAAGCTGTGGTTCCCGTGGGACCGCAAGGCGAAGAAGGAT
GGCACGGATACGTGCTGGGTGCGGGTCAGCCAGGCATGGGGTGGCGGCACTTGGGGTGCGCAGGTCATTC
CGCGCATCGGCATGGAGGTGATGGTTGCTTTTGTCGATGGCGATCCTGATAAGCCGCTGGTTATCGGCGT
GGTCAACAATCCCGCCAATTCCGTGCCTTACGACCTGCCGGCCAACAAGACGCGTATGGTGCTGCGCTCC
AACAGTCACAAGGGTGACGGTTTCAACGAAATCACTTTCGAAGATGAAGCCGGCAAGGAGAACCAGTTCT
TCCACGCCCAGAAGGACCAGACGACGCGGGTCTTGAACGACCGGACCAAACGCATCGACCGGCACGAGGT
CGCCTCGGTCGGCGGCAACCGCGCCGTCGAGGTTTCCGGCAACCAGAAACACGAGATCGGTGGTTCGGTG
AATACTGTCGTCGGCGGAACGGGACCGATGGCGATGATGGCGATGGCAGGCGTGCAGGCGCTTTCAGGAC
AGACGGCTGGCCTGCTTTCACAGGCCGCCCAGATTGCCGGCGGTGGTGGTCCTGGTGTCGCAGCCTTTGC
CACCACGCTTGCCTCATCCGCACTCGGATTTCTTGGTGCAGGCGGACTTTCCTCGCGCGAGGGCGTTGTC
TCCGGTCCAAGCCCGCGGGCGGATGCGGGTACGGCACTTGCCGGCTCCGGCTCGGGCGTCGGTTCCGATG
CCTCGGGCCTCTTTCCGCTGCCGGGCATCATGAACACGATCATCGGGGCGTTTCAGTCCACATCCGTTGG
AGTGGCAAAAGCCGAGCAGGTCGGGGTCAGCAAGGTCACGAATATCGGGCAGACGGAAGTCCGACAGGTT
GGAAAACAGCAGAACCTGACCATCGGCAAAGAGCAATTCGTCGAGATCGGTACCGGCCAATATACGCGTG
TCGGTGAGAAGATCACCATCAATGTCGGCAAGCTCTACAATCTCGTCTCCGAAGAGAAATATCATGGCGA
GGCGAAGGTCTGGGAGATATTCGCCGACGACGAAATTCGTCTTTCGACTCCCGGCGGATACATCTCCCTG
ACTAAAAGCGGCATCAAGCTCTTTGCCCTGAAGATCGATATCGAAGGCAACCAGATCAACTTCAAGAAAG
GTGGCCCAGGTGAAAGTGGCTCCTGCTTGAAGTCGATGTCGAAGAATTCCACACCGTTTGTCAGGATTTG
A