SecReT6
Protein ID: 15890640
SecReT6 ID16
T6SS typei5
Gene symbolimpA
Locus tagAtu4343
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1475984..1477039 [-]
Producthypothetical protein
NoteTssA
UniProt IDA9CGG7
KEGG IDatu:Atu4343
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.70E-17, Aligned region: 59..114
Protein Sequence: 351 a.a.     [Download]
>gi|15890640|ref|NP_356312.1| hypothetical protein Atu4343 [Agrobacterium tumefaciens str. C58]
MDTQHVKRDIEFLGNCGDNIRNDSRTREIYYRIKDERNQARAEERAASPQDNLKISSSWDSVSNLGLQII
YSESKDVEILAWLAEASLRLRGFHGLREIYELCGDLFYNHWDSLRSISDDNDEEKFAPFAGLNGIGSEGT
LVQPLRLASLIPGGKFGEHSLWDFQLAQRPNESKRREELYRIASEAGVAAMSSHLAAVNTCLSSFDAITA
VLSERCGQAAPPSSNIRNTLIEAAAAIRTLGGRDQEPAPVEQTPAIAAGTDESGQSAARTSPASPEGISS
RDEAFETLLSVARYFRRTEPHSPISLSIETLVRRGRMDFSELLAELLPETQARNAVLTAAGIKPGGDNNG
K
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1477039-1475984 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
TTGGATACACAGCATGTTAAAAGAGATATAGAGTTTTTGGGGAATTGCGGAGATAATATCCGCAACGATT
CAAGAACGCGTGAAATATACTATAGAATTAAGGACGAAAGAAACCAGGCACGCGCAGAAGAGCGGGCCGC
CTCCCCTCAGGATAACCTGAAGATCTCCAGTAGCTGGGACAGTGTCAGCAATCTTGGATTGCAGATTATA
TATTCCGAAAGCAAGGATGTTGAAATATTGGCATGGCTTGCGGAAGCAAGCCTGCGACTTCGCGGCTTCC
ATGGACTGCGCGAAATCTACGAGCTTTGTGGTGATCTTTTTTACAACCACTGGGACTCATTGCGCTCGAT
CAGCGACGATAATGACGAAGAAAAATTTGCACCTTTTGCGGGATTGAATGGCATTGGCAGCGAGGGAACA
CTTGTTCAGCCACTCAGGCTGGCATCGCTGATCCCCGGAGGCAAATTCGGAGAACACAGTCTCTGGGATT
TCCAGCTGGCGCAGCGGCCGAACGAGAGCAAACGCCGCGAAGAACTGTACCGGATAGCCTCCGAGGCCGG
TGTTGCCGCCATGTCTTCCCATCTGGCAGCGGTGAATACCTGTCTCTCCTCGTTTGACGCCATTACCGCC
GTTCTTTCCGAACGTTGCGGCCAGGCCGCCCCCCCGAGCTCCAATATCCGCAACACGCTTATCGAAGCGG
CCGCGGCAATTCGCACGCTGGGTGGGCGCGACCAGGAACCGGCACCGGTCGAACAGACGCCGGCCATTGC
TGCGGGCACCGATGAAAGCGGGCAGTCGGCCGCGCGGACATCCCCGGCATCCCCGGAAGGCATATCTTCG
CGCGATGAGGCGTTTGAAACTCTTCTTTCGGTTGCGCGTTACTTTCGCCGAACCGAACCGCATTCACCGA
TCTCGCTCTCCATCGAAACGCTGGTTCGCAGGGGGCGCATGGATTTCTCGGAACTGCTGGCCGAGCTTCT
GCCGGAAACGCAGGCCCGAAACGCCGTTCTGACGGCCGCCGGCATCAAACCCGGCGGAGACAATAACGGG
AAATAA