SecReT6
Protein ID: 15890642
SecReT6 ID16
T6SS typei5
Gene symbolimpC
Locus tagAtu4341
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1473834..1475315 [-]
Producthypothetical protein
NoteTssC
UniProt IDA9CGG5
KEGG IDatu:Atu4341
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-190, Aligned region: 64..490
Protein Sequence: 493 a.a.     [Download]
>gi|15890642|ref|NP_356314.1| hypothetical protein Atu4341 [Agrobacterium tumefaciens str. C58]
MSAESLLKSEAQATTAENQGLLSKVVSATRQTEPDRAQNLLRTLTDQALKGTVKYDRNLTVTLNHAIAEL
DRTISEQLAAIMQAPEFAKLEGTWRGLNYLVKNSETSVNLKIRVMNAGKRELARDLEKAVEFDQSRLFKA
IYEDEFGTPGGEPLGAIIGDYEFGNSFDDVQLLQGVSSIAAAAFAPFISAASPHMFGFEDYRDLARPRDL
EKIFDTVEYAKWRSFRESDDSRFVTLALPRVLARMPYGPKTNPVDDFAYDETRGAVNGDLQHDEYCWMNA
AYVMGTKLTEAFAKSGWCTAIRGAENGGRVENLPMHVFSSDDGDLDLKCPTEVGITDRRDAELGKLGFLP
LCHYKNTDYAVFFGAQTAHKPKLYDKPEATANAAVSARLPYIMATSRFAHYLKVMGRDKIGSFMEASDCE
VWLNRWIANYVNANDEAGEESRAKYPLRDAKVTVQEVPGKPGAYNAVAWMRPWLQMEELTTSLRMVARIP
SKN
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1475315-1473834 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGAGCGCTGAAAGCCTGCTGAAAAGCGAAGCACAGGCAACGACCGCCGAAAATCAGGGACTGCTGTCCA
AGGTGGTTTCCGCAACCCGCCAGACCGAACCGGATCGCGCGCAGAACCTCTTGCGCACGCTGACCGATCA
GGCCCTGAAGGGAACGGTCAAATATGACCGCAACCTCACGGTCACCCTCAATCACGCGATCGCCGAGCTG
GACCGGACGATTTCCGAGCAGCTCGCTGCCATCATGCAGGCGCCGGAATTCGCCAAGCTGGAAGGCACCT
GGCGCGGGCTCAACTATCTCGTCAAAAATTCCGAGACGAGCGTGAACCTCAAGATCCGTGTCATGAACGC
CGGCAAGCGTGAACTGGCGCGCGATCTGGAAAAAGCCGTCGAATTCGATCAGTCCCGCCTCTTCAAGGCG
ATCTACGAAGACGAATTCGGCACGCCTGGCGGCGAACCGCTCGGCGCCATCATCGGTGATTACGAATTCG
GCAATTCCTTCGATGACGTACAGCTGCTGCAGGGCGTCTCATCGATCGCGGCGGCGGCTTTCGCGCCGTT
CATCTCGGCCGCCAGCCCGCACATGTTCGGTTTCGAGGACTATCGCGACCTCGCCCGTCCGCGTGATCTG
GAGAAAATTTTCGATACGGTGGAATATGCCAAGTGGCGCAGCTTCCGCGAAAGCGACGATTCCCGTTTCG
TTACGCTCGCCTTGCCGCGTGTGCTGGCCCGCATGCCCTATGGTCCAAAGACCAACCCCGTCGATGATTT
CGCCTATGACGAAACCAGGGGCGCGGTGAATGGCGATCTGCAGCATGACGAATATTGCTGGATGAACGCC
GCCTACGTCATGGGCACCAAGCTAACCGAGGCTTTTGCAAAGAGCGGCTGGTGCACGGCGATCCGCGGTG
CGGAAAATGGCGGCCGGGTGGAAAACCTGCCCATGCACGTCTTCTCCAGCGATGACGGCGATCTGGACCT
GAAATGCCCGACCGAAGTGGGCATCACCGACCGCCGCGATGCGGAACTCGGCAAGCTCGGCTTCCTGCCG
CTCTGCCACTACAAGAACACGGATTATGCGGTGTTCTTCGGTGCCCAGACCGCACACAAACCGAAGCTTT
ACGACAAGCCGGAAGCTACGGCCAACGCCGCCGTTTCCGCCCGCCTGCCCTATATCATGGCGACCTCGCG
CTTCGCGCATTATCTCAAGGTGATGGGCCGCGACAAGATCGGCTCCTTCATGGAAGCGTCCGACTGCGAA
GTCTGGCTCAACCGCTGGATCGCCAACTACGTCAACGCCAATGACGAAGCGGGCGAAGAAAGCCGGGCGA
AGTATCCACTGCGCGATGCCAAGGTGACCGTGCAGGAAGTGCCCGGCAAACCCGGCGCCTACAACGCGGT
CGCATGGATGCGGCCCTGGTTGCAGATGGAAGAACTGACGACCTCGCTGCGCATGGTCGCCCGTATTCCG
TCCAAGAACTGA