SecReT6
Protein ID: 15890646
SecReT6 ID16
T6SS typei5
Gene symbolimpG
Locus tagAtu4337
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1469288..1471069 [-]
Producthypothetical protein
NoteTssF
UniProt IDA9CGG3
KEGG IDatu:Atu4337
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.20E-191, Aligned region: 5..593
Protein Sequence: 593 a.a.     [Download]
>gi|15890646|ref|NP_356318.1| hypothetical protein Atu4337 [Agrobacterium tumefaciens str. C58]
MADGFLEKYNDELFALRKRASRFAAAFPKIAGRLRMTGDVADDPHVERLIQSFAYSAARVRQKLDDEFPE
LSDSLLETLYPHYLAPIPSMSVVQFAPSPALATVQTLARHSEILAEPVGGESCRFRTTQEVQIAPLQIAA
ATLAGQPIDAPFSASFAGTASCLRLSLRSTAPRGGTFPEMGLTKLQVFLSAAWQQATALYELLTNHCVGM
ALARHSEDKEAIFLPAGNLRPSGFTRDQAMLPYPANSFDGYRLLTEFFALPQKFLFLDIDGLHRWSGGDC
ELYIYLDAADAQLERMVSVKDFVLNASPVINLFKQSCEPLSLDGTRTEYRLLPDARRQRTREIYAVEDVQ
LTSRSGQSEKTSPFFGRTQRNNGANVFWQIQRRFDDDGSSDTDIAFVDEKRGPLGPLDVVASIDTLCINR
ELPSQLPFGGGHPFLQLSTGNEAVKSVHALMPPTAAIRVNERSAREWRLISHLLLNHLSLTDSGGAPLKD
ILSLYSFRDSPETRQLVEAISKVEAQNSHARIGATMVPGTDITVEFDPALIARPAAFVFAGVLNHFFGLY
TSINSFTRLTATMRGHSKPIARWPARAADRPLL
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1471069-1469288 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGGCTGACGGCTTCCTCGAAAAATACAATGACGAGCTTTTTGCGCTGCGAAAACGCGCTTCGCGCTTTG
CGGCGGCGTTTCCGAAGATCGCTGGCAGGCTGCGCATGACTGGTGATGTCGCCGACGATCCGCATGTCGA
GCGGCTGATCCAGAGCTTTGCCTATTCCGCCGCCCGCGTGCGCCAAAAGCTGGACGACGAATTTCCCGAA
TTGTCAGACAGCCTGCTGGAAACGCTCTATCCGCATTATCTTGCGCCGATCCCTTCGATGAGCGTCGTGC
AATTCGCTCCGAGTCCGGCGCTGGCAACCGTACAGACGCTTGCCCGTCACAGCGAAATCCTCGCCGAACC
CGTGGGCGGCGAAAGCTGCCGTTTCCGCACCACGCAGGAGGTGCAGATCGCGCCGCTGCAGATCGCGGCA
GCGACGCTTGCCGGCCAGCCGATCGACGCGCCTTTTTCGGCATCCTTTGCCGGCACTGCCAGTTGCCTGC
GGCTTTCGCTGCGCAGCACGGCGCCGCGCGGCGGCACATTCCCGGAAATGGGACTGACGAAACTCCAGGT
CTTCCTGTCCGCTGCATGGCAGCAGGCAACGGCGCTTTACGAGCTTTTGACCAACCATTGCGTCGGCATG
GCGCTTGCCCGTCATTCCGAGGACAAGGAAGCCATCTTCCTGCCGGCCGGCAATCTCAGACCTTCCGGGT
TCACTCGCGATCAGGCCATGTTGCCCTATCCGGCCAACAGCTTTGACGGATACAGGCTTCTCACCGAATT
CTTCGCGCTGCCGCAGAAGTTTCTCTTTCTCGATATTGACGGGCTGCACAGATGGAGCGGCGGTGATTGC
GAGCTTTATATCTACCTGGATGCCGCCGATGCGCAGCTTGAGCGCATGGTGTCGGTCAAGGATTTCGTGC
TGAACGCGTCTCCGGTCATCAACCTCTTCAAGCAAAGCTGCGAACCGCTCAGCCTAGATGGAACCCGGAC
CGAATACCGCCTGCTGCCGGATGCACGCCGCCAGCGGACCCGCGAGATATACGCGGTCGAAGACGTCCAG
CTGACCAGCCGTTCCGGGCAGAGCGAGAAAACCTCTCCCTTCTTCGGCCGCACCCAACGCAACAATGGTG
CGAATGTGTTCTGGCAGATCCAGCGCCGGTTCGACGATGATGGCTCCTCCGATACCGACATCGCCTTCGT
GGATGAAAAGCGCGGACCGCTGGGGCCGCTCGACGTGGTAGCGAGCATCGACACGCTCTGCATCAACCGC
GAGCTGCCGAGCCAGCTTCCGTTTGGTGGTGGGCACCCCTTCCTGCAACTTTCGACCGGCAATGAAGCGG
TGAAATCGGTCCATGCGCTGATGCCGCCGACGGCGGCGATCCGCGTCAACGAACGCTCGGCGCGCGAGTG
GCGGCTGATATCGCATCTTCTCCTCAACCATCTTTCCCTCACCGATAGCGGCGGCGCTCCGCTGAAAGAT
ATTCTGTCGCTTTATTCCTTCAGAGACAGCCCGGAAACCCGGCAGCTCGTGGAGGCGATCAGCAAGGTCG
AAGCCCAGAATTCCCACGCCCGCATCGGCGCGACGATGGTACCCGGCACCGACATAACGGTGGAGTTCGA
TCCTGCGCTGATCGCACGGCCTGCGGCCTTTGTATTCGCCGGCGTCCTCAACCATTTCTTCGGGCTTTAC
ACCTCGATCAACAGCTTTACGCGGCTGACGGCGACGATGCGTGGCCATTCCAAACCAATTGCCCGCTGGC
CGGCCCGCGCCGCTGACCGGCCGTTGCTTTAG