SecReT6
Protein ID: 15890647
SecReT6 ID16
T6SS typei5
Gene symbolimpH
Locus tagAtu4336
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1468274..1469278 [-]
Producthypothetical protein
NoteTssG
UniProt IDA9CGG2
KEGG IDatu:Atu4336
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-66, Aligned region: 37..310
Protein Sequence: 334 a.a.     [Download]
>gi|15890647|ref|NP_356319.1| hypothetical protein Atu4336 [Agrobacterium tumefaciens str. C58]
MDQQMPTIKDRQAALLSDDPGRFEPTTAFRVAQFVAADDGVVIGAHGGTQPTPLAVSGFNQKRGHAELKS
AFAPIVGPLGSLPPAYGELLQREERNRSAALASFFNLFAARFSELFVAATEKYRLARGLRWSAREQDNGF
RKTLLALTGFRTTGLAQKAGVAEDTLLRFSGLLASRNRNVSALTSMLCEFTALPVTVEQFRRRWVALPLH
EQSQLGQASGLRLGQNTTAGSAVEDMSGGFRVVIGPVGYADYLALTPGSKRLAEIFALTRLFVGSALHFD
VQVILKKEDIPFCRLGQSDAPARLGWNSWARVAPAEKDSADAVVTEREGSAISV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1469278-1468274 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGGACCAGCAAATGCCAACCATAAAAGACCGGCAGGCCGCGCTTCTCAGCGACGATCCCGGCCGTTTCG
AACCCACCACCGCGTTTCGTGTTGCCCAATTCGTCGCAGCGGATGACGGGGTCGTCATCGGTGCTCATGG
CGGCACACAGCCGACACCGCTCGCGGTCAGCGGTTTTAATCAAAAGCGCGGCCATGCCGAACTGAAATCC
GCCTTCGCCCCGATCGTCGGTCCGCTTGGGTCGCTGCCGCCGGCCTATGGCGAATTGCTGCAACGGGAAG
AACGTAATCGTTCCGCGGCGCTCGCGAGCTTCTTCAATCTGTTCGCGGCAAGGTTCAGCGAGCTTTTCGT
CGCCGCAACGGAGAAATATCGCCTCGCAAGGGGCCTGCGCTGGTCGGCCAGGGAACAGGACAACGGTTTC
CGCAAAACCCTGCTGGCGCTGACGGGGTTCAGGACGACGGGACTGGCACAGAAGGCCGGCGTTGCCGAAG
ACACACTTCTGCGTTTCAGCGGGCTGTTGGCCAGCCGCAACCGAAATGTCAGCGCGCTCACCTCCATGCT
GTGCGAGTTCACCGCGCTTCCGGTCACGGTCGAACAGTTTCGGCGGCGCTGGGTGGCTTTGCCGCTTCAC
GAACAAAGCCAGCTCGGACAGGCCTCCGGACTGAGGCTGGGGCAGAACACGACGGCAGGAAGCGCTGTCG
AAGATATGAGCGGCGGCTTCCGGGTGGTGATCGGCCCCGTCGGCTATGCCGACTATCTGGCCCTGACGCC
CGGATCGAAGCGGCTTGCGGAAATATTCGCGCTGACGCGCCTGTTCGTTGGAAGCGCGCTGCATTTCGAT
GTGCAGGTGATCCTGAAAAAGGAGGACATTCCCTTTTGCCGCCTCGGCCAGTCCGATGCGCCCGCCCGTC
TCGGCTGGAACAGCTGGGCCCGCGTGGCACCCGCAGAAAAAGACAGCGCCGATGCTGTTGTGACCGAGCG
CGAAGGCTCGGCTATTTCCGTGTGA