SecReT6
Protein ID: 15890648
SecReT6 ID16
T6SS typei5
Gene symbolimpI
Locus tagAtu4335
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1467064..1468263 [-]
Productforkhead-type phosphopeptide-binding protein
NoteFha
UniProt IDA9CGG1
KEGG IDatu:Atu4335
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.30E-16, Aligned region: 28..93
Protein Sequence: 399 a.a.     [Download]
>gi|15890648|ref|NP_356320.1| forkhead-type phosphopeptide-binding protein [Agrobacterium tumefaciens str. C58]
MKLALKNTRNIGTGKAGQWSFERGRRAIGRSRDCDWQIDDNERRVSKLHCTLSRDGEGFIILDQSANGTL
VDGRLLLEGESARLRDGSQINIGGQIFEVAISGNAELDFSDPDASLKMSDETLTISAILADIAPNGRSAG
GLLGNTAAADDWPETRRESAGRKAKSISRNVEIGWSEPPSAQGIGTVLPDDWDTEPAASSDHEHTDALNT
PVMISRPVSASHDRDFDSVFPDTDEDPIRQGRLPADTATAQEIGDLLTALERESADCLAILDIESDHAGQ
GPAPSLSERMETLIGQQRRLAASLETLMHGCTQKLEPRLLEAAVDAGNDFRAKIGRRDWQGLVMKTDYWS
AYKKQFEENGRPLPVRQFLQRAARGEAASARETDATAADAKGVNNHDET
 
Nucleotide Sequence: 1200 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1468263-1467064 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGAAGCTTGCACTCAAGAACACACGGAACATCGGGACGGGAAAAGCCGGCCAGTGGAGCTTCGAGCGAG
GCCGCCGCGCAATTGGCCGGTCTCGTGATTGCGACTGGCAGATCGATGACAATGAGCGGCGCGTTTCCAA
GCTGCATTGCACGCTGAGCCGCGACGGCGAAGGTTTCATCATCCTCGACCAGAGCGCAAACGGCACGCTC
GTCGATGGCCGTCTGTTGCTTGAGGGCGAAAGCGCGCGTCTTCGGGACGGTTCGCAGATCAATATCGGCG
GGCAGATTTTCGAGGTCGCCATCAGCGGCAATGCGGAGCTCGATTTTTCCGATCCCGACGCCTCGCTGAA
GATGAGTGACGAGACGCTGACCATTTCGGCGATCCTTGCCGATATCGCCCCGAACGGCCGTTCTGCCGGC
GGCCTGCTGGGCAACACCGCCGCCGCCGATGACTGGCCGGAAACACGGCGCGAAAGCGCGGGCCGGAAGG
CGAAGTCCATTTCGCGCAACGTCGAGATCGGCTGGAGCGAACCGCCCTCTGCGCAGGGAATTGGCACTGT
TCTGCCTGATGACTGGGATACGGAGCCGGCTGCAAGCAGCGACCACGAACATACCGATGCGCTGAACACG
CCGGTCATGATCTCACGTCCGGTCTCGGCTTCGCATGACCGGGATTTTGACAGCGTTTTCCCGGATACAG
ACGAAGACCCGATCCGCCAGGGCAGATTGCCCGCGGACACGGCGACCGCACAGGAGATCGGCGATCTTCT
GACGGCACTGGAAAGGGAAAGTGCCGATTGCCTGGCCATCCTCGACATTGAGAGCGATCATGCCGGCCAA
GGCCCGGCACCATCCCTCAGCGAGCGAATGGAAACGCTCATTGGCCAGCAGCGCCGTCTTGCCGCCTCGC
TCGAAACCCTCATGCATGGCTGCACGCAGAAACTCGAGCCCCGGCTTCTTGAGGCCGCTGTCGATGCCGG
CAACGATTTTCGCGCGAAGATCGGGCGCAGAGACTGGCAGGGGCTGGTCATGAAGACCGACTACTGGTCG
GCTTACAAAAAACAATTCGAAGAAAACGGCCGTCCATTGCCGGTCAGGCAGTTCCTGCAGCGGGCAGCGC
GTGGTGAAGCCGCGTCCGCACGGGAGACTGACGCGACCGCGGCCGATGCCAAGGGGGTAAACAACCACGA
TGAGACATGA