SecReT6
Protein ID: 15890649
SecReT6 ID16
T6SS typei5
Gene symbolimpJ
Locus tagAtu4334
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1465734..1467074 [-]
Producthypothetical protein
NoteTssK
UniProt IDA9CGG0
KEGG IDatu:Atu4334
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.00E-156, Aligned region: 19..445
Protein Sequence: 446 a.a.     [Download]
>gi|15890649|ref|NP_356321.1| hypothetical protein Atu4334 [Agrobacterium tumefaciens str. C58]
MRHENRVAWSEGMFLRVQHFQQSDRWTERLVRNTTRNLSPYPWGIAEIGVDRSALSIGQFALSNLRGVLP
DGTPFEAPEDSDLPPPLDLDESVKNAIIYLALPARQPGKADMSTSGRNDTNNVRFTASSYEVTDTNIETD
FVAPIDVGRLSLKFLKTGDDLSGYDLIGLARVIEVRSDRAVILDPDFIPPSLSCAAAPRLNELLTELLGI
VRHRAQAIAERIGDPTIRGTAEVGDYFLLQILNRADPLLAHRGANATRFHPIRFYEDCIQLAGELATFTT
DRKRATDFPPYRHEDLKATFGAVFDDLRTSLSAVLEQAAVAIELVERRHGVRVGTIHDRTLLRDAGFVLA
VRADMAAEDIRRRLPAQIKVGPVERISELVNVALPGIPVRSLPVLPRQLPYRSGTVYFEIDTQSPLWKQL
DTSGAIALHLAGEFPGLEMEMWALRE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1467074-1465734 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGAGACATGAGAACCGTGTTGCCTGGAGCGAGGGCATGTTTCTTCGCGTTCAGCATTTTCAGCAATCCG
ACCGCTGGACCGAACGTCTGGTGCGCAACACCACGCGCAACCTTTCGCCCTACCCCTGGGGCATCGCCGA
GATCGGTGTGGACCGCAGCGCATTATCGATAGGGCAATTCGCGCTGTCGAACCTGCGCGGCGTGCTTCCC
GACGGCACACCCTTCGAGGCACCTGAGGATTCCGACCTGCCGCCGCCGCTCGATCTCGATGAAAGCGTCA
AGAACGCCATCATCTATCTTGCCCTGCCGGCCCGGCAGCCGGGCAAGGCGGATATGTCCACCAGCGGCCG
CAATGACACGAACAATGTGCGCTTCACCGCCTCGAGCTATGAAGTCACCGACACCAATATCGAAACGGAT
TTCGTGGCCCCGATCGACGTCGGCCGCCTCAGCCTGAAATTCCTCAAAACCGGTGACGATCTTTCCGGTT
ACGATCTCATCGGGCTGGCGCGGGTGATCGAAGTCCGCTCCGACCGTGCGGTCATCCTCGATCCGGATTT
CATTCCTCCAAGCCTCAGCTGTGCAGCAGCGCCCCGCCTCAACGAATTGCTGACGGAGCTTCTGGGGATC
GTGCGCCACCGGGCCCAGGCGATTGCCGAACGCATCGGCGACCCGACGATCCGGGGAACGGCGGAAGTGG
GCGATTATTTCCTTCTGCAGATCCTCAACCGGGCCGATCCGCTGCTCGCGCATCGCGGTGCCAACGCCAC
ACGTTTTCACCCCATCCGCTTTTACGAAGACTGCATCCAGCTTGCCGGAGAGCTTGCCACCTTCACCACG
GACAGGAAGCGGGCGACGGATTTCCCGCCCTACCGGCACGAAGATCTGAAAGCCACCTTCGGTGCTGTCT
TTGATGATCTGCGCACCTCGCTGTCGGCAGTTCTGGAGCAGGCAGCCGTGGCAATCGAACTGGTGGAACG
CCGCCATGGCGTCCGCGTCGGCACCATCCACGACCGCACGCTTCTGCGCGATGCTGGTTTCGTGCTGGCC
GTGCGCGCGGATATGGCCGCCGAGGATATTCGCCGCCGCCTGCCGGCACAGATCAAGGTCGGACCGGTGG
AACGGATTTCCGAACTGGTCAATGTGGCGCTGCCGGGCATCCCCGTGCGGTCCCTGCCGGTCCTGCCGCG
GCAACTGCCCTATCGATCCGGCACCGTCTATTTCGAGATCGACACGCAGTCGCCGCTCTGGAAACAGCTT
GATACCTCAGGTGCCATTGCCCTGCATCTGGCGGGCGAGTTCCCCGGGCTTGAAATGGAAATGTGGGCGT
TACGCGAATGA