SecReT6
Protein ID: 159186121
SecReT6 ID16
T6SS typei5
Gene symbolimpK
Locus tagAtu4333
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1464232..1465737 [-]
ProductOmpA-like porin
NoteTssL
UniProt IDQ7CUN4
KEGG IDatu:Atu4333
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-57, Aligned region: 74..278
OmpA [PF00691], Evalue: 7.10E-14, Aligned region: 367..464
Protein Sequence: 501 a.a.     [Download]
>gi|159186121|ref|NP_356322.2| OmpA-like porin [Agrobacterium tumefaciens str. C58]
MSTDNPSSWQDLPTVVEITEESRRRNQNARNMAAILEDIVETDEQARPARGKVATLPVDKLLTGFHFGGE
EVPTLVQSAAPLLNLAHLLRFSDAEPDPDQLRRACVEAITRYERDLASARISPERARAAHYVVCATVDDV
VLSKPWGVRAGWARSGLVSTFHNDVTGGDRVFDILDHFHQSPGANKDLLLLIYLCLSLAFEGRTRVSSKG
ALELSRIRDSLYKTLIGQYGTFERELSPHWKGVDARHTPLRTMTALWTLLSLMALAFALGYLFFTLSLNN
ASDVTFERLAHLPPTETPSVLISNPPPHPPAQVEIPRVVEPPKTVAPRQPSRLEKLMAFLQPEVDKKLVT
LADVNGRLRVRINNSGLFTTGSADVSPQFRDLIQRIGGALAAEKFRAVVIGYTDTVPIKTVEFPSNWHLS
EARAKAVGDILSQFTGPDAILTEGRADSDPIADNKTEEGRQINRRTEIMVLTNPDEKLSDAGILSPPIEN
SSGQQPGEAQP
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1465737-1464232 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGAGCACGGACAACCCCTCTTCCTGGCAGGATTTGCCGACGGTGGTCGAGATCACCGAGGAAAGCCGCC
GGCGCAACCAGAACGCCCGCAACATGGCGGCGATCCTCGAAGACATCGTCGAGACCGACGAGCAGGCTCG
CCCCGCCAGGGGGAAAGTGGCCACCCTACCGGTCGACAAGCTGCTGACCGGTTTCCACTTCGGCGGAGAG
GAGGTGCCGACACTTGTGCAATCGGCGGCTCCCCTTCTCAACCTCGCACATCTGCTGCGCTTCAGCGATG
CCGAGCCGGACCCCGACCAGCTTCGCCGCGCCTGCGTGGAGGCGATCACCCGTTATGAGCGCGATCTCGC
TTCCGCCCGCATCAGCCCCGAGCGGGCAAGAGCGGCGCATTACGTCGTCTGCGCAACCGTGGATGATGTC
GTTCTCAGCAAGCCCTGGGGTGTGCGGGCCGGCTGGGCGCGCTCCGGCCTCGTTTCCACCTTCCACAATG
ACGTGACCGGTGGCGACCGGGTTTTCGACATTCTCGACCATTTCCACCAGTCGCCCGGCGCCAACAAGGA
TCTGCTGCTGCTGATCTATCTGTGCCTGTCGCTGGCTTTCGAAGGACGCACCCGCGTTTCATCGAAAGGG
GCACTGGAGCTTTCACGCATCCGCGACAGTCTCTACAAGACGCTGATCGGCCAATATGGCACCTTCGAGC
GGGAGCTTTCTCCACATTGGAAAGGCGTCGATGCCCGCCATACGCCACTGCGGACGATGACCGCGCTGTG
GACCCTGCTGTCGCTGATGGCACTCGCCTTCGCGCTTGGTTATCTCTTCTTCACGCTATCGCTCAACAAC
GCATCCGATGTCACCTTCGAAAGGCTTGCCCATCTGCCGCCGACCGAGACGCCGAGCGTGCTGATCTCGA
ACCCGCCGCCCCACCCACCGGCGCAAGTCGAAATTCCCAGGGTTGTCGAGCCGCCGAAGACGGTGGCGCC
GAGACAACCCTCCCGGCTTGAAAAGCTGATGGCCTTCCTGCAGCCGGAAGTCGACAAGAAGCTTGTGACC
CTTGCGGATGTGAACGGGCGGCTGCGGGTTCGCATCAACAATTCGGGCCTGTTCACGACAGGCAGCGCCG
ATGTCAGCCCGCAGTTCCGCGATCTCATCCAGCGTATCGGCGGTGCGCTTGCGGCTGAAAAATTCCGCGC
CGTCGTCATCGGTTATACCGACACCGTGCCGATCAAGACGGTGGAGTTTCCATCGAACTGGCACCTTTCC
GAGGCGCGCGCCAAGGCGGTCGGAGACATTCTTTCACAATTCACCGGCCCCGACGCAATCCTGACCGAAG
GCCGAGCCGACAGCGACCCGATCGCCGACAACAAAACGGAAGAAGGCCGCCAGATAAACCGCAGAACAGA
AATCATGGTCCTGACCAATCCCGATGAAAAACTGAGCGACGCCGGCATTCTCTCGCCGCCCATAGAGAAC
AGTTCGGGACAGCAGCCGGGAGAGGCCCAGCCATGA