SecReT6
Protein ID: 159186122
SecReT6 ID16
T6SS typei5
Gene symbolimpF
Locus tagAtu4338
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1471062..1471571 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ7CUN9
KEGG IDatu:Atu4338
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 8.10E-18, Aligned region: 42..144
Protein Sequence: 169 a.a.     [Download]
>gi|159186122|ref|NP_356317.2| hypothetical protein Atu4338 [Agrobacterium tumefaciens str. C58]
MVDPLEQYRARQRTLSRSILDRLLDDAPDAETDMLVSLKDQASEMREVIRRDLEALLNTRRNPAGPPAVL
KELADALVSYGVDGILSANLVTDASKAQLARSIERRISLFETRLADVHVTILKNRTDGDRALRMRIQASF
RLQEGMPPISFESRIDPSTQRFLVEATNG
 
Nucleotide Sequence: 510 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1471571-1471062 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
GTGGTTGATCCGCTGGAGCAATATCGCGCACGGCAAAGGACGCTGTCGCGCTCCATTCTGGACCGGCTGC
TCGATGACGCGCCGGACGCGGAAACGGATATGCTCGTCAGTCTGAAGGATCAGGCCAGCGAGATGCGCGA
GGTGATCCGCCGCGATCTCGAGGCATTGCTCAATACCCGCCGCAACCCCGCCGGACCGCCAGCCGTTTTG
AAGGAATTGGCAGATGCGCTGGTGAGCTATGGCGTGGACGGCATTCTTTCGGCCAATCTGGTGACGGATG
CCTCCAAGGCGCAGCTCGCACGCAGCATCGAGCGGCGGATTTCCCTGTTCGAAACCCGCCTTGCCGATGT
GCATGTGACGATCCTGAAAAACCGCACGGATGGCGACCGGGCGCTTCGCATGCGCATACAGGCAAGCTTC
CGTCTTCAGGAAGGCATGCCGCCGATCAGCTTTGAATCCCGCATCGATCCGTCCACGCAACGTTTCTTGG
TGGAGGCGACGAATGGCTGA