SecReT6
Protein ID: 159186123
SecReT6 ID16
T6SS typei5
Gene symbolimpD
Locus tagAtu4340
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1472385..1473779 [-]
Producthypothetical protein
NoteTssC
UniProt IDA9CGG4
KEGG IDatu:Atu4340
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-150, Aligned region: 14..444
Protein Sequence: 464 a.a.     [Download]
>gi|159186123|ref|NP_356315.2| hypothetical protein Atu4340 [Agrobacterium tumefaciens str. C58]
MAHQSFPDARIFADQLIALIDEALTGQVNAILHHPDFQAMEGRWRGLAMVVREAGRSTDVKVKLLNASWR
DLARNTERATDFDQSHLFEVVYNREFGMPGGEPVGLMIGDYAFSPDDLQGADSITTLSQIGMVAAAAFCP
FVAAAAPSAVGLQDFSELSRVHDFSSLKQEKSRLRWNALRARDDSRFVGLVAPRVLLRSPYRPYARGRDD
GFPFREHVAESGETLLWGNAAFAFATVVVRNFVDSGWFADLRGVTQDAVDGGMLSPRQLPPFDLGIESNG
LSAQPPVEVQLTTGQEQQFSDLGIVPVSTTYLSGMAIFNANQSLHAPGHYSTEAARQNARLAAMLQYVLC
ASRFSHYLKVIMRDDIGQLSDATTIERKLESWLSSYTLGNDDAEASLRTRYPLRSAGINVFEVPGKPGTF
SCTVRLQPHFQLDDVSTSFHLIAETMMPPAAASRSSAEPQRISA
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|159185562|ref|NC_003063.2|:c1473779-1472385 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGGCGCATCAGTCCTTTCCGGACGCCCGCATTTTCGCCGACCAGCTCATCGCCCTCATCGATGAGGCGC
TGACCGGCCAGGTGAACGCCATTCTCCACCATCCCGATTTTCAGGCGATGGAGGGGAGATGGCGCGGGCT
CGCCATGGTCGTGCGCGAAGCGGGCCGCAGCACCGACGTGAAGGTGAAACTGCTGAACGCCAGCTGGCGC
GACCTTGCCCGGAACACGGAACGCGCCACCGACTTCGACCAGAGCCATCTTTTCGAAGTCGTCTATAACC
GCGAATTCGGCATGCCCGGCGGCGAACCGGTGGGCTTGATGATCGGTGACTACGCCTTTTCTCCCGATGA
TCTTCAGGGTGCAGATTCCATCACCACGCTGTCGCAGATCGGCATGGTGGCCGCTGCGGCCTTCTGCCCC
TTCGTGGCGGCAGCCGCACCTTCCGCCGTCGGCCTGCAGGATTTTTCCGAACTCAGCCGGGTTCATGACT
TTTCCTCGCTGAAGCAGGAGAAATCTCGGCTTCGCTGGAATGCGCTTCGCGCCCGCGATGATTCTCGCTT
CGTCGGCCTTGTCGCGCCGCGTGTTTTGCTGCGCTCTCCCTACAGGCCCTATGCGCGTGGACGCGATGAC
GGGTTTCCATTCCGCGAACATGTGGCGGAAAGCGGCGAGACACTGCTCTGGGGTAATGCCGCCTTCGCCT
TTGCGACCGTGGTCGTGCGCAACTTCGTCGATTCCGGCTGGTTTGCGGATCTGCGCGGTGTGACGCAGGA
TGCGGTGGATGGCGGCATGCTCTCGCCCCGGCAATTGCCGCCGTTCGATCTCGGCATCGAGAGCAACGGT
CTTTCCGCCCAGCCGCCCGTCGAGGTGCAACTGACGACGGGACAGGAACAGCAGTTTTCCGATCTCGGCA
TCGTGCCCGTCTCCACCACCTATCTTTCCGGCATGGCAATCTTCAACGCCAACCAGTCCCTGCATGCACC
CGGCCATTATTCCACCGAAGCGGCGAGGCAGAACGCCCGCCTTGCCGCGATGCTGCAATATGTGCTGTGC
GCCTCCCGGTTCTCGCATTATCTCAAGGTCATCATGCGTGATGACATCGGCCAGCTGAGCGATGCCACGA
CGATCGAGCGCAAGCTGGAAAGCTGGCTCTCTTCCTACACGCTCGGCAATGACGATGCGGAAGCGTCGTT
GCGCACGCGCTATCCGCTGCGCTCTGCCGGGATCAATGTCTTCGAGGTTCCCGGCAAGCCGGGGACATTC
TCCTGCACCGTGCGCCTCCAGCCGCATTTCCAGCTCGATGACGTCTCCACGAGCTTCCACCTCATTGCCG
AAACCATGATGCCGCCCGCCGCCGCATCCCGGTCTTCGGCCGAGCCGCAAAGGATATCCGCATGA