SecReT6
Protein ID: 159186125
SecReT6 ID16
T6SS typei5
Gene symbolclpB
Locus tagAtu4344
StrainAgrobacterium tumefaciens str. C58
Repliconchromosome linear [GenBank: NC_003063] [Browse all T6SS(s) in this replicon]
Location [Strand]1477260..1479938 [+]
ProductATP-dependent Clp protease, ATP-binding subunit
NoteTssH
UniProt IDQ7CUP5
KEGG IDatu:Atu4344
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.30E-38, Aligned region: 222..299
AAA_2 [PF07724], Evalue: 3.30E-38, Aligned region: 594..758
AAA [PF00004], Evalue: 4.30E-20, Aligned region: 223..334
AAA [PF00004], Evalue: 4.30E-20, Aligned region: 599..725
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 223..243
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 598..724
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 200..243
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 268..301
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 348..454
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 566..622
AAA_16 [PF13191], Evalue: 7.00E-14, Aligned region: 663..691
ClpB_D2-small [PF10431], Evalue: 3.20E-11, Aligned region: 766..840
Sigma54_activat [PF00158], Evalue: 6.20E-08, Aligned region: 201..242
Sigma54_activat [PF00158], Evalue: 6.20E-08, Aligned region: 588..714
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 223..303
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 356..467
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 598..620
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 660..679
Clp_N [PF02861], Evalue: 8.10E-07, Aligned region: 24..73
Zeta_toxin [PF06414], Evalue: 5.50E-06, Aligned region: 217..247
Zeta_toxin [PF06414], Evalue: 5.50E-06, Aligned region: 307..380
Zeta_toxin [PF06414], Evalue: 5.50E-06, Aligned region: 591..638
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 221..296
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 425..475
AAA_25 [PF13481], Evalue: 7.10E-06, Aligned region: 595..616
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 223..254
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 598..638
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 223..265
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 447..478
AAA_17 [PF13207], Evalue: 5.40E-05, Aligned region: 598..633
Arch_ATPase [PF01637], Evalue: 6.70E-05, Aligned region: 202..238
Arch_ATPase [PF01637], Evalue: 6.70E-05, Aligned region: 276..377
Arch_ATPase [PF01637], Evalue: 6.70E-05, Aligned region: 593..610
AAA_18 [PF13238], Evalue: 0.00011, Aligned region: 223..255
AAA_18 [PF13238], Evalue: 0.00011, Aligned region: 599..628
AAA_19 [PF13245], Evalue: 0.00016, Aligned region: 220..244
AAA_19 [PF13245], Evalue: 0.00016, Aligned region: 597..620
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 217..243
IstB_IS21 [PF01695], Evalue: 0.00018, Aligned region: 598..616
PhoH [PF02562], Evalue: 0.0013, Aligned region: 208..245
PhoH [PF02562], Evalue: 0.0013, Aligned region: 597..616
DUF2075 [PF09848], Evalue: 0.0032, Aligned region: 225..325
DUF2075 [PF09848], Evalue: 0.0032, Aligned region: 596..632
ResIII [PF04851], Evalue: 0.0042, Aligned region: 209..254
ResIII [PF04851], Evalue: 0.0042, Aligned region: 291..304
ResIII [PF04851], Evalue: 0.0042, Aligned region: 570..617
TBPIP [PF07106], Evalue: 0.0056, Aligned region: 426..482
SRP54 [PF00448], Evalue: 0.0069, Aligned region: 223..243
SRP54 [PF00448], Evalue: 0.0069, Aligned region: 596..620
Protein Sequence: 892 a.a.     [Download]
>gi|159186125|ref|NP_356311.2| ATP-dependent Clp protease, ATP-binding subunit [Agrobacterium tumefaciens str. C58]
MSHIDLNRLVGALEPDLRVTLEAAASVAVRMGHRYVDIPHWLLAVVDAGIYAETFDELKIPLPVLKAEIG
RSLEEAIIGDGEALSLSQNILTAAREAWILASLEAGRDRVTLCDLLLAMDEETSLRSFVRSAFPSLKAMD
RGALERLRSSAENGAGVDVPSALTSSGEAGSAQAAGQNDFLRLYTHDMTTDARNGKVDPVIGRDDELRQL
VDILTRRRQNNPILVGEAGVGKTAVAEALALEIASGNVPEKLRNVCLLNLDISLLQAGAGVKGEFERRLH
GVIDAVKRSAEPVILFIDEAHGLVGAGGAAGQGDAANILKPALARGEVRTVAATTWSEYKKYFEKDAALT
RRFQPVHVREPDEATAIRMLRGVADTFVSHHNVTVRDEAIVAAVQLSARYMPARQLPDKAVSLLDTAAAA
VSLARQTLPERLRAMESERHLLSDELNWLLREPQDEDMQNRIQSIRDELERLEAGIDDLRGRYDAEMAEL
AALSEEQPAETGASNVSHLRPATEMRPANAERLVPTVVDREAIAAVVSRWTGIPLGKLLADQIESARTLD
VRMRQRVVGQDAAITRIADAMRTARAGLSDPRRPPAVFFLVGMSGTGKTETALSLADLLYGGNSHLTTIN
MSEFKEEHKVSLLLGSPPGYVGFGEGGVLTEAVRRRPFGVLLLDEIDKAHPGVQDIFYQVFDKGVLRDGE
GRDVDFKNTTIFMTANTGSELLSALSADPDTMPEGEALEALLMPELTKQFKPAFLGRTIILPFMPLGAEE
LASVVDMQIGKIRDRVLATYGTDLRLSDAARDALVARAGASEIGARAIEIMIGKDLLPPLSSFFLEKVIA
GERVGKIVVDFGENGFGIRAEAAGEADEFAVTEEVGVDKVAASDGATRRMRH
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|159185562|ref|NC_003063.2|:1477260-1479938 Agrobacterium tumefaciens str. C58 chromosome linear, complete sequence
ATGTCGCATATCGATCTCAATCGCCTCGTTGGAGCGCTTGAGCCAGACCTGCGCGTTACCCTCGAAGCTG
CGGCTTCCGTTGCGGTGCGTATGGGGCACAGGTACGTGGATATACCGCATTGGCTGCTGGCGGTTGTAGA
TGCCGGTATCTATGCGGAAACATTCGACGAATTAAAAATTCCACTTCCGGTATTGAAGGCTGAAATCGGC
CGCAGTCTGGAAGAGGCCATTATCGGCGACGGGGAGGCCTTGTCGCTCTCCCAGAACATCCTCACGGCAG
CCCGGGAGGCATGGATTCTTGCGTCGCTGGAGGCTGGCCGTGACCGCGTGACGCTTTGCGATCTCCTGTT
GGCGATGGATGAGGAAACCTCACTTCGCTCCTTTGTCCGCTCGGCATTTCCGTCTCTCAAGGCGATGGAT
CGCGGTGCGCTTGAGCGTCTTCGCAGCTCGGCCGAGAACGGCGCAGGCGTGGATGTTCCTTCCGCGCTGA
CAAGTTCAGGAGAGGCAGGCTCGGCACAGGCCGCCGGCCAGAATGATTTCTTGCGCCTTTACACCCACGA
CATGACCACCGATGCCCGCAACGGCAAGGTCGATCCTGTTATCGGCCGCGATGATGAGTTGCGCCAGCTC
GTTGATATTCTGACCCGCCGCCGACAGAACAATCCTATTCTGGTGGGCGAGGCCGGCGTGGGCAAGACCG
CGGTCGCCGAAGCGCTGGCGTTGGAAATCGCCTCCGGCAACGTTCCGGAGAAACTGCGCAATGTCTGCCT
GCTGAACCTCGATATTTCGCTGCTGCAGGCCGGTGCCGGCGTGAAAGGTGAGTTCGAGCGGCGCCTGCAC
GGCGTGATCGATGCGGTCAAGCGTTCGGCCGAACCGGTCATCCTGTTCATCGATGAGGCCCATGGCCTTG
TTGGCGCGGGTGGTGCGGCGGGCCAGGGTGATGCGGCGAATATTCTTAAGCCCGCACTCGCACGAGGCGA
GGTGCGGACCGTCGCGGCAACGACGTGGAGTGAATACAAGAAATATTTCGAGAAGGATGCGGCGCTGACG
CGTCGTTTCCAGCCAGTGCATGTGCGCGAGCCGGACGAGGCGACTGCGATACGGATGTTGCGCGGTGTGG
CGGATACTTTCGTCAGCCATCACAACGTTACCGTTCGTGATGAGGCGATCGTGGCTGCCGTGCAATTATC
CGCGCGCTACATGCCCGCTCGGCAATTGCCGGACAAGGCGGTCAGCCTGCTCGATACCGCCGCCGCGGCC
GTTTCGCTGGCGCGGCAGACGTTGCCAGAGCGGTTACGTGCCATGGAAAGCGAGCGACACCTTCTGTCTG
ACGAACTGAACTGGCTTCTGCGTGAACCGCAGGATGAGGACATGCAAAACCGCATCCAGTCGATACGCGA
CGAGCTTGAACGGCTTGAGGCCGGGATCGATGATCTGCGCGGCCGTTATGACGCGGAAATGGCTGAACTG
GCGGCGCTCAGTGAAGAGCAGCCGGCCGAAACCGGCGCGTCGAATGTTTCGCACCTGCGGCCTGCCACGG
AGATGCGGCCCGCAAATGCCGAAAGACTTGTTCCGACAGTGGTTGATCGTGAAGCGATCGCCGCCGTCGT
CTCGCGATGGACCGGGATTCCGCTCGGCAAACTTCTGGCGGACCAGATCGAAAGCGCCCGCACTCTGGAT
GTGCGCATGCGGCAGCGCGTGGTTGGGCAGGATGCCGCAATTACCCGGATTGCCGATGCCATGCGCACCG
CCCGTGCCGGATTGTCCGATCCGCGCCGTCCGCCGGCGGTGTTTTTCCTTGTCGGCATGTCCGGAACGGG
CAAGACCGAAACGGCGCTGTCGCTGGCCGATCTTCTCTATGGCGGCAACAGCCATCTGACGACGATCAAC
ATGTCGGAGTTCAAGGAGGAGCACAAGGTTTCCCTGCTTCTCGGCTCACCGCCTGGCTATGTCGGTTTCG
GCGAAGGTGGGGTGCTGACGGAAGCGGTGCGCCGCCGGCCGTTCGGCGTTCTGCTTCTCGATGAAATCGA
CAAGGCTCACCCCGGCGTCCAGGATATTTTTTATCAGGTGTTCGACAAGGGCGTGCTTCGCGATGGCGAA
GGCCGCGACGTCGATTTCAAGAACACCACGATCTTCATGACGGCCAATACCGGTTCGGAATTGCTGTCGG
CGCTTTCCGCCGATCCCGACACTATGCCGGAAGGTGAGGCGCTGGAAGCGCTTCTGATGCCGGAGCTTAC
CAAACAGTTCAAGCCCGCATTCCTCGGGCGCACGATCATCCTGCCCTTCATGCCGCTTGGCGCGGAGGAG
CTTGCAAGTGTCGTGGACATGCAGATTGGCAAGATCAGGGACCGTGTGCTCGCAACATATGGCACCGACC
TGAGATTGTCCGATGCGGCGCGCGATGCCTTGGTGGCGCGCGCCGGTGCAAGTGAAATCGGCGCACGCGC
CATCGAAATCATGATCGGCAAGGATCTCCTGCCGCCTCTTTCCAGCTTTTTCCTCGAGAAGGTCATCGCG
GGAGAACGCGTCGGGAAGATCGTTGTCGATTTTGGTGAAAACGGGTTCGGCATTCGTGCGGAAGCGGCTG
GGGAAGCAGATGAATTCGCCGTAACCGAAGAGGTTGGGGTGGATAAAGTTGCCGCGTCGGATGGGGCTAC
CCGACGCATGCGGCATTAA