SecReT6
Protein ID: 160899275
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3841
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4232891..4234936 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDA9BLI7
KEGG IDdac:Daci_3841
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.30E-07, Aligned region: 30..97
Protein Sequence: 681 a.a.     [Download]
>gi|160899275|ref|YP_001564857.1| FHA domain-containing protein [Delftia acidovorans SPH-1]
MDKIELRVVDHDGVPVDRHWHAVFGMAGGTIGRSGQNKLIISDPDASVARVHAMVRLDSEGAFVANLSER
DPIWVAEQPVRSGQEVGLPLGARIRIGAYTLAAVAPGTPFEAPPSAAMQNAQAAQATQAAAPPATAAPQP
QIVPPPVAVQPPLQEATPLADILPAAAPGIADPWEGLTALSLDAIQTPAVPSIESAIPPEQAALAMPQPA
KPQHRPLLIPNDFDPFAPPPQQARQQEEGWAGLPSQGTGELIQQRHDGMVHTLPLKGLSTEALHDASHTG
LPSCFEQSQKLDPLALFDQGGLPPDAQPLQQASGRGSELGQAFNLPRMQSHAQPAEPVPPQEAAAPAQPA
LPPVIDTVIPAVQEQLPAQVEARAQAQDIPVAAPAPAPVPQIPAEPAALDGLLPTNGLDLDLFKSGLAHA
APVARATVAAASAPPLDAGINVNIPATSSILGQGDAAIPIGALPSTAAPVDIPVQPQPAANADLQALAAA
FMEGAGLNPAKTHFEVTPEFMRTFGEALRIAVQGTIDLLAARSEIKREFRAGVTIIATGANNPLKFLPNS
EGVLMQMVHQTFPGFMKPLPAMQDAFQDLHVHQLALMAGIRAAYAEALTRFDPTELERRTETNPGLLDKL
LTNGRKAALWDDYKHNFDVLRRHAEDDLMAFSGRTFVEAYENAEQSVKGQP
 
Nucleotide Sequence: 2046 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4232891-4234936 Delftia acidovorans SPH-1 chromosome, complete genome
ATGGACAAAATCGAACTCAGGGTCGTGGACCACGATGGCGTTCCGGTCGATCGCCACTGGCATGCCGTAT
TCGGCATGGCCGGCGGCACGATCGGACGCAGTGGCCAGAACAAGCTCATCATCTCGGACCCGGACGCTTC
CGTCGCGCGCGTGCACGCCATGGTCAGGCTGGATTCCGAGGGAGCCTTTGTTGCGAACCTGAGCGAGCGT
GATCCCATCTGGGTGGCAGAGCAGCCCGTGCGTTCGGGCCAGGAAGTGGGCCTGCCCCTGGGCGCGCGCA
TCCGTATCGGCGCCTACACCCTGGCCGCCGTGGCGCCGGGCACGCCTTTCGAGGCACCGCCTTCGGCTGC
AATGCAAAACGCGCAGGCCGCGCAAGCAACGCAGGCAGCGGCCCCACCCGCCACAGCCGCCCCGCAGCCC
CAGATCGTCCCGCCTCCCGTCGCCGTCCAGCCCCCGCTGCAGGAAGCAACGCCGCTGGCAGACATATTGC
CTGCCGCCGCCCCCGGCATCGCCGATCCCTGGGAAGGCCTGACGGCACTGAGCCTGGATGCCATCCAGAC
CCCTGCCGTGCCTTCGATCGAGAGCGCCATCCCGCCCGAGCAGGCTGCACTGGCCATGCCGCAGCCCGCC
AAGCCGCAGCATCGCCCCCTGCTGATCCCCAATGATTTCGACCCCTTTGCTCCGCCGCCCCAGCAAGCTC
GCCAGCAGGAGGAAGGCTGGGCCGGCCTGCCATCGCAAGGCACGGGCGAGCTGATACAGCAGCGCCATGA
CGGCATGGTACACACCCTGCCGCTCAAGGGCCTGAGCACCGAGGCCTTGCATGATGCCTCCCATACCGGC
CTGCCTTCGTGCTTCGAGCAATCCCAAAAGCTCGACCCGCTTGCGCTGTTCGACCAGGGTGGACTGCCCC
CCGATGCGCAGCCGCTGCAGCAGGCCTCGGGCCGGGGCTCCGAACTGGGCCAGGCCTTCAATCTGCCGCG
CATGCAGTCGCATGCACAGCCCGCAGAGCCGGTGCCACCGCAGGAGGCGGCAGCACCGGCCCAGCCCGCA
CTCCCGCCCGTGATCGATACCGTGATTCCTGCAGTGCAGGAGCAGCTTCCTGCACAGGTAGAGGCACGGG
CACAGGCACAGGACATCCCGGTTGCCGCGCCTGCCCCGGCGCCCGTGCCCCAGATCCCCGCCGAGCCGGC
CGCGCTGGACGGTCTGCTGCCCACCAATGGACTGGATCTGGACCTCTTCAAGTCCGGTCTTGCCCATGCT
GCGCCCGTCGCCAGGGCTACCGTTGCCGCTGCCTCGGCTCCCCCCCTTGACGCAGGCATCAACGTCAATA
TCCCCGCGACCTCCAGCATCCTCGGCCAGGGCGACGCCGCCATCCCCATCGGCGCCCTGCCCTCCACAGC
CGCGCCTGTCGATATTCCCGTGCAGCCCCAGCCGGCCGCCAACGCCGATCTGCAGGCACTGGCCGCCGCC
TTCATGGAGGGCGCAGGCCTGAACCCGGCCAAGACCCATTTCGAGGTCACACCGGAATTCATGCGCACTT
TCGGCGAAGCCCTGCGCATTGCCGTGCAGGGAACCATCGACCTGCTGGCCGCGCGCTCCGAGATCAAGCG
CGAGTTCCGCGCCGGCGTGACCATCATTGCCACGGGCGCCAACAACCCGCTCAAGTTCCTGCCCAATTCC
GAGGGCGTGCTCATGCAGATGGTCCACCAGACCTTCCCGGGCTTCATGAAGCCGCTGCCTGCCATGCAGG
ACGCCTTCCAGGACCTGCATGTGCACCAGCTGGCCCTGATGGCCGGCATCCGCGCCGCCTATGCCGAGGC
CCTGACCCGGTTCGATCCGACCGAGCTGGAGCGCCGAACAGAAACCAACCCCGGCCTGCTGGACAAGCTG
CTGACCAATGGCCGCAAGGCCGCCCTGTGGGACGACTACAAGCACAACTTCGACGTGCTGCGCCGCCATG
CCGAGGACGACCTGATGGCCTTTTCTGGCCGCACCTTCGTCGAGGCCTACGAAAACGCCGAGCAGTCCGT
GAAAGGCCAGCCGTGA