SecReT6
Protein ID: 160899277
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3843
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4235741..4236340 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDA9BLI9
KEGG IDdac:Daci_3843
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.60E-33, Aligned region: 32..188
Protein Sequence: 199 a.a.     [Download]
>gi|160899277|ref|YP_001564859.1| putative lipoprotein [Delftia acidovorans SPH-1]
MWRSQEPQGSQGRRQALQTLGALGLGTAVVTGLAGCGSLNPLSRAPEVAPTAVPTAIFEVVADMDINPDR
EGIPKPVLLRIYELRASAAFDRAGFFDLQDKDDGQLGSDFVRREEFLVAPGQRQVIERKGNPDVRAFGLF
AAYRDLERSTWRASAVAPNSVELRRRWWGMGSTEKLQPVRYQVHLTREEVTVRIQPASQ
 
Nucleotide Sequence: 600 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4235741-4236340 Delftia acidovorans SPH-1 chromosome, complete genome
ATGTGGAGATCACAGGAACCGCAGGGATCGCAGGGGCGCCGGCAGGCGCTGCAAACGCTGGGCGCCTTGG
GCCTGGGCACGGCCGTGGTGACCGGCCTGGCCGGCTGCGGCTCCCTCAACCCCCTGAGCCGCGCGCCCGA
AGTGGCGCCCACAGCCGTGCCCACCGCCATATTCGAAGTGGTGGCGGACATGGACATCAACCCGGACCGT
GAAGGCATTCCCAAGCCCGTGCTGCTGCGCATCTACGAGCTGCGCGCCTCCGCCGCCTTCGACCGCGCCG
GCTTCTTCGACCTGCAGGACAAGGACGACGGCCAGCTGGGCAGCGACTTCGTGCGGCGCGAGGAATTCCT
GGTCGCGCCCGGCCAGCGCCAGGTGATTGAGCGCAAGGGCAACCCAGATGTGCGCGCCTTCGGCCTGTTC
GCCGCCTACCGCGATCTGGAGCGCAGCACCTGGCGCGCCTCGGCCGTCGCGCCCAACTCCGTGGAGCTGC
GCCGGCGCTGGTGGGGCATGGGCTCCACCGAAAAGCTGCAGCCCGTGCGCTACCAGGTGCACCTGACCCG
CGAAGAGGTCACCGTCCGCATTCAACCCGCATCCCAATAA