SecReT6
Protein ID: 160899278
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3844
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4236358..4237692 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDA9BLJ0
KEGG IDdac:Daci_3844
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.90E-159, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|160899278|ref|YP_001564860.1| type VI secretion protein [Delftia acidovorans SPH-1]
MVWQRKVIWAEGMFLRPQHFQQQERFLFRQLQSRSLPGQPFFWGFSELELDTDLLRMGKLGIRSAHGVLP
DGTPFQLPGDDEAPTPLDIGKDFKDVVVHLALPLRRFSGSEVTFGEGSQSPARYLSDVTEVADSNDVGAQ
PAEVQLGRLRLSLRPAHELTEGWVSLPVAHVVERQASGGVLLEPGFIPTVVNNGPSSVLNTFCKEIHGLL
RQRGEVLAQRMIQPERGGIGEVGDFLLLQLINHWTGAAQHWVRTASIHPERLFEELLRLAAELTTFDHER
RRPEVLPAYDHDDLRRSFPPLMLELRRSLSSVLEQNAIQIPLHDRQYGVRVALIPSTELLTTCDFVLAAH
AQTTPEFLRTHFPTQTKLGPVERIRDLVNLHLPGVTLRPLPIAPREIPYHAGYNYFEVDTTHDLWNQLQS
SGGLAMHVSGEFPDLQLEFWAIRR
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4236358-4237692 Delftia acidovorans SPH-1 chromosome, complete genome
ATGGTCTGGCAACGCAAAGTCATCTGGGCCGAGGGCATGTTCCTTCGGCCCCAGCACTTCCAGCAGCAGG
AGCGCTTCCTGTTCCGGCAACTGCAGTCACGCAGCCTGCCGGGGCAGCCCTTTTTCTGGGGCTTCTCGGA
ACTGGAGCTGGACACCGATCTGCTGCGCATGGGCAAGCTGGGCATTCGTTCGGCCCACGGCGTGCTGCCC
GACGGCACGCCGTTCCAGCTGCCGGGCGACGACGAGGCGCCCACCCCGCTGGACATCGGCAAGGACTTCA
AGGACGTGGTGGTCCACCTGGCGCTGCCGCTGCGCCGCTTCTCTGGCAGCGAAGTGACCTTTGGCGAAGG
CTCCCAGAGCCCTGCGCGCTATCTCAGCGACGTGACCGAAGTGGCGGACAGCAACGACGTGGGTGCCCAG
CCCGCCGAGGTGCAGCTGGGCCGGCTGCGCCTGAGCCTGCGCCCCGCCCACGAACTGACCGAAGGCTGGG
TCAGCCTGCCCGTGGCCCATGTGGTGGAGCGCCAGGCCAGCGGCGGCGTGCTGCTGGAGCCCGGCTTCAT
CCCCACCGTGGTCAACAACGGGCCCAGCTCGGTGCTCAACACCTTCTGCAAGGAAATCCACGGCCTGCTG
CGCCAGCGCGGCGAAGTGCTGGCCCAGCGCATGATCCAGCCCGAGCGCGGCGGCATCGGCGAGGTCGGCG
ACTTCCTGCTGCTGCAGCTCATCAACCACTGGACGGGCGCAGCCCAGCACTGGGTGCGCACCGCCAGCAT
CCACCCCGAGCGCCTGTTCGAGGAACTGCTGCGCCTGGCCGCCGAGCTGACCACCTTCGACCACGAGCGC
CGCCGCCCCGAGGTGCTGCCCGCCTACGACCATGACGACCTGCGGCGCAGCTTCCCGCCGCTGATGCTGG
AGCTGCGGCGCAGCCTGTCCTCGGTGCTGGAGCAAAACGCCATCCAGATCCCGCTGCACGACCGCCAGTA
CGGCGTGCGCGTGGCGCTGATCCCGTCCACCGAACTGCTCACCACCTGCGACTTCGTGCTGGCCGCCCAT
GCCCAGACCACGCCGGAATTCCTGCGCACCCACTTCCCCACCCAGACCAAGCTGGGCCCGGTGGAGCGCA
TACGCGACCTGGTGAATCTGCACCTGCCCGGCGTCACGCTGCGGCCCCTGCCCATTGCCCCGCGCGAGAT
TCCCTACCACGCGGGCTACAACTATTTCGAGGTGGACACCACGCACGACCTGTGGAACCAGCTGCAAAGC
TCCGGCGGCCTTGCCATGCACGTCTCCGGCGAATTCCCCGACCTGCAACTGGAGTTCTGGGCCATCCGCC
GCTGA